Reviewed,
UniProtKB/Swiss-Prot O15021 (MAST4_HUMAN)
Last modified
July 22, 2008.
Version 63.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Microtubule-associated serine/threonine-protein kinase 4 EC=2.7.11.1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2444 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium By similarity. |
| Subcellular location | CytoplasmPotential. |
| Tissue specificity | Highly expressed in most normal human tissues, with an exception of in testis, small intestine, colon and peripheral blood leukocyte. |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. Contains 1 AGC-kinase C-terminal domain. Contains 1 PDZ (DHR) domain. Contains 1 protein kinase domain. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: O15021-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: O15021-2) The sequence of this isoform differs from the canonical sequence as follows: 1-42: MKAQRERLQIPGLTLDLTPRSLSPTPSSPGSPCSPLLAFHFW → MDMSDPNFWTVLSNFTLPHLRSGNRLRRTQ 97-99: Missing. | |||||
| Notes: No experimental confirmation available. | |||||
| Isoform 3 (identifier: O15021-3) The sequence of this isoform differs from the canonical sequence as follows: 1-43: MKAQRERLQI...SPLLAFHFWS → MDESSILRRR...SQKWNCLVKR 97-99: Missing. | |||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2444 | 2444 | Microtubule-associated serine/threonine-protein kinase 4 | |||||
Regions | ||||||||
| Domain | 391 – 664 | 274 | Protein kinase | |||||
| Domain | 665 – 737 | 73 | AGC-kinase C-terminal | |||||
| Domain | 962 – 1050 | 89 | PDZ | |||||
| Nucleotide binding | 397 – 405 | 9 | ATP By similarity | |||||
| Compositional bias | 844 – 958 | 115 | Ser-rich | |||||
| Compositional bias | 1102 – 1164 | 63 | Ser-rich | |||||
| Compositional bias | 1946 – 2029 | 84 | Pro-rich | |||||
Sites | ||||||||
| Active site | 514 | 1 | Proton acceptor By similarity | |||||
| Binding site | 420 | 1 | ATP By similarity | |||||
Amino acid modifications | ||||||||
| Modified residue | 1240 | 1 | Phosphoserine | |||||
| Modified residue | 1733 | 1 | Phosphothreonine | |||||
| Modified residue | 1737 | 1 | Phosphoserine | |||||
Natural variations | ||||||||
| Alternative sequence | 1 – 43 | 43 | MKAQR…FHFWS → MDESSILRRRGLQKELSLPR RGSLIDSQKWNCLVKR in isoform 3. | |||||
| Alternative sequence | 1 – 42 | 42 | MKAQR…AFHFW → MDMSDPNFWTVLSNFTLPHL RSGNRLRRTQ in isoform 2. | |||||
| Alternative sequence | 97 – 99 | 3 | Missing in isoform 2 and isoform 3. | |||||
| Natural variant | 741 | 1 | Q → R | |||||
| Natural variant | 1775 | 1 | R → W | |||||
| Natural variant | 2019 | 1 | P → L | |||||
| Natural variant | 2111 | 1 | S → C | |||||
| Natural variant | 2288 | 1 | E → D in a lung squamous cell carcinoma sample; somatic mutation. | |||||
Experimental info | ||||||||
| Sequence conflict | 171 | 1 | H → R in AAW52510. Ref.1 | |||||
| Sequence conflict | 171 | 1 | H → R in BAB71532. Ref.2 | |||||
| Sequence conflict | 483 | 1 | M → T in BAD18568. Ref.2 | |||||
| Sequence conflict | 495 – 499 | 5 | FAETV → YIVKL in BAB71532. Ref.2 | |||||
| Sequence conflict | 504 – 505 | 2 | YL → FT in BAD18568. Ref.2 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Identification of a novel human MAST4 gene, a new member of the microtubule associated serine-threonine kinase family." Sun L., Gu S., Li X., Sun Y., Zheng D., Yu K., Ji C., Tang R., Xie Y., Mao Y. Mol. Biol. (Mosk.) 40:808-815(2006) [PubMed: 17086981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-505 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-484 (ISOFORM 2). Tissue: Brain and Thymus. |
| [3] | "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 4:141-150(1997) [PubMed: 9205841] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 308-2444 (ISOFORM 1). Tissue: Brain. |
| [4] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1733 AND SER-1737, MASS SPECTROMETRY. Tissue: Epithelium. |
| [5] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1240, MASS SPECTROMETRY. |
| [6] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-741; TRP-1775; LEU-2019; CYS-2111 AND ASP-2288. |
Cross-references
Sequence databases | |
|---|---|
| AY830839 mRNA. Translation: AAW52510.1. AK057601 mRNA. Translation: BAB71532.1. AK131421 mRNA. Translation: BAD18568.1. AB002301 mRNA. Translation: BAA20762.1. | |
| RefSeq | NP_055998.1. |
| UniGene | Hs.595458 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1MRY based on UniProtKB P31751. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | O15021. |
Genome annotation databases | |
| Ensembl | ENSG00000069020. Homo sapiens. [Contig view] |
| GeneID | 375449. |
| KEGG | hsa:375449. |
Organism-specific databases | |
| HGNC | HGNC:19037. MAST4. |
| HPA | HPA000544. |
| PharmGKB | PA134920494. |
| HUGE | Search... |
| GenAtlas | Search... |
| GeneCards | Search... |
| GeneLynx | Search... |
Phylogenomic databases | |
| HOVERGEN | O15021. |
Gene expression databases | |
| ArrayExpress | O15021. |
| CleanEx | HS_MAST4. |
| GermOnline | ENSG00000069020. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR015022. DUF1908. IPR001478. PDZ. IPR000961. Pkinase_C. IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_bd_CS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] |
| Pfam | PF08926. DUF1908. 1 hit. PF00595. PDZ. 1 hit. PF00069. Pkinase. 1 hit. PF00433. Pkinase_C. 1 hit. [ |

Clusters with