Reviewed,
UniProtKB/Swiss-Prot O15392 (BIRC5_HUMAN)
Last modified
December 16, 2008.
Version 107.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Baculoviral IAP repeat-containing protein 5 Alternative name(s): Apoptosis inhibitor survivin Apoptosis inhibitor 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 142 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May play a role in neoplasia. May counteract a default induction of apoptosis in G2/M phase. Interacts with tubulin. Inhibitor of caspase-3 and caspase-7. Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Isoforms 2 and 3 do not appear to play vital roles in mitosis. Isoform 3 shows a marked reduction in its anti-apoptotic effects when compared with the displayed wild-type isoform. Ref.2 Ref.14 Ref.16 Ref.21 |
| Subunit structure | Homodimer. When phosphorylated, interacts with HBXIP; the resulting complex binds pro-caspase-9, as well as active caspase-9, but much less efficiently. Component of the CPC at least composed of BIRC5/survivin, CDCA8/borealin, INCENP and AURKB/Aurora-B. Interacts with EVI5. Ref.16 Ref.21 Ref.17 Ref.18 Ref.19 Ref.20 Ref.22 |
| Subcellular location | Cytoplasm. Nucleus. Centromere. Note= Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes. Ref.16 Ref.3 |
| Tissue specificity | Expressed only in fetal kidney and liver, and to lesser extent, lung and brain. Abundantly expressed in adenocarcinoma (lung, pancreas, colon, breast, and prostate) and in high-grade lymphomas. Also expressed in various renal cell carcinoma cell lines. Ref.2 Ref.4 Ref.5 |
| Domain | The BIR repeat is necessary and sufficient for HBXIP binding. |
| Sequence similarities | Belongs to the IAP family. Contains 1 BIR repeat. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-518838,EBI-518838 | ||
| AURKB | Q96GD4 | 1 | EBI-518823,EBI-624291 | |
| AURKB | Q96GD4 | 2 | EBI-518838,EBI-624291 | |
| AURKB | Q96GD4 | 2 | EBI-518842,EBI-624291 | |
| BIRC5 | O15392-1 | 2 | EBI-518842,EBI-518838 | |
| BIRC5 | O15392-2 | 2 | EBI-518838,EBI-518842 | |
| Birc6 | O88738 | 1 | EBI-518823,EBI-912068 | From a different organism. |
| CASP9 | P55211 | 1 | EBI-518823,EBI-516799 | |
| CDC2 | P06493 | 1 | EBI-518823,EBI-444308 | |
| CDCA8 | Q53HL2 | 2 | EBI-518823,EBI-979174 | |
| CDCA8 | Q53HL2 | 2 | EBI-518838,EBI-979174 | |
| CDCA8 | Q53HL2 | 2 | EBI-518842,EBI-979174 | |
| PPP1CC | P36873-1 | 1 | EBI-518823,EBI-356289 | |
| USF2 | Q15853 | 1 | EBI-518823,EBI-1055994 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15392-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15392-2) Also known as: 2B; Beta; The sequence of this isoform differs from the canonical sequence as follows: 74-74: I → IGPGTVAYACNTSTLGGRGGRITR | ||||||
| Isoform 3 (identifier: O15392-3) Also known as: DeltaEx3; The sequence of this isoform differs from the canonical sequence as follows: 74-142: IEEHKKHSSG...RAIEQLAAMD → MQRKPTIRRK...SLPVGPLAMS | ||||||
| Isoform 4 (identifier: O15392-4) Also known as: 3B; The sequence of this isoform differs from the canonical sequence as follows: 114-142: AKETNNKKKEFEETAEKVRRAIEQLAAMD → ERALLAE | ||||||
| Isoform 5 (identifier: O15392-5) Also known as: SI; The sequence of this isoform differs from the canonical sequence as follows: 105-142: DRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD → VRETLPPPRSFIR | ||||||
| Isoform 6 (identifier: O15392-6) Also known as: 3 alpha; The sequence of this isoform differs from the canonical sequence as follows: 74-142: IEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD → MRELC | ||||||
| Isoform 7 (identifier: O15392-7) Also known as: 2 alpha; The sequence of this isoform differs from the canonical sequence as follows: 74-142: IEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 142 | 142 | Baculoviral IAP repeat-containing protein 5 | PRO_0000122356 | |||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||
| Repeat | 18 – 88 | 71 | BIR | ||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||
| Metal binding | 57 | 1 | Zinc | ||||||||||||||||||||||||||
| Metal binding | 60 | 1 | Zinc | ||||||||||||||||||||||||||
| Metal binding | 77 | 1 | Zinc | ||||||||||||||||||||||||||
| Metal binding | 84 | 1 | Zinc | ||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||
| Modified residue | 34 | 1 | Phosphothreonine; by CDC2 Ref.15 Ref.23 Ref.24 | ||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||
| Alternative sequence | 74 – 142 | 69 | IEEHK…LAAMD → MQRKPTIRRKNLRKLRRKCA VPSSSWLPWIEASGRSCLVP EWLHHFQGLFPGATSLPVGP LAMS in isoform 3. | VSP_020338 | |||||||||||||||||||||||||
| Alternative sequence | 74 – 142 | 69 | IEEHK…LAAMD → MRELC in isoform 6. | VSP_020339 | |||||||||||||||||||||||||
| Alternative sequence | 74 – 142 | 69 | IEEHK…LAAMD → M in isoform 7. | VSP_020340 | |||||||||||||||||||||||||
| Alternative sequence | 74 | 1 | I → IGPGTVAYACNTSTLGGRGG RITR in isoform 2. | VSP_002454 | |||||||||||||||||||||||||
| Alternative sequence | 105 – 142 | 38 | DRERA…LAAMD → VRETLPPPRSFIR in isoform 5. | VSP_020341 | |||||||||||||||||||||||||
| Alternative sequence | 114 – 142 | 29 | AKETN…LAAMD → ERALLAE in isoform 4. | VSP_020342 | |||||||||||||||||||||||||
| Natural variant | 129 | 1 | E → K: dbSNP rs2071214. | VAR_021071 | |||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||
| Mutagenesis | 34 | 1 | T → A: Loss of HBXIP binding Ref.16 | ||||||||||||||||||||||||||
| Mutagenesis | 34 | 1 | T → E: Higher affinity for HBXIP binding Ref.16 | ||||||||||||||||||||||||||
| Mutagenesis | 84 | 1 | C → A: Loss of cytoprotection | ||||||||||||||||||||||||||
| Sequence conflict | 57 – 58 | 2 | CF → WV in AAW22624. Ref.5 | ||||||||||||||||||||||||||
| Sequence conflict | 58 | 1 | F → L in BAD97148. Ref.10 | ||||||||||||||||||||||||||
| Sequence conflict | 128 | 1 | A → V in CAG46540. Ref.9 | ||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||
| Turn | 8 – 10 | 3 | |||||||||||||||||||||||||||
| Helix | 11 – 13 | 3 | |||||||||||||||||||||||||||
| Helix | 15 – 20 | 6 | |||||||||||||||||||||||||||
| Helix | 35 – 40 | 6 | |||||||||||||||||||||||||||
| Beta strand | 43 – 45 | 3 | |||||||||||||||||||||||||||
| Beta strand | 55 – 57 | 3 | |||||||||||||||||||||||||||
| Turn | 58 – 60 | 3 | |||||||||||||||||||||||||||
| Helix | 73 – 80 | 8 | |||||||||||||||||||||||||||
| Helix | 85 – 88 | 4 | |||||||||||||||||||||||||||
| Helix | 93 – 95 | 3 | |||||||||||||||||||||||||||
| Helix | 98 – 139 | 42 | |||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel anti-apoptosis gene, survivin, expressed in cancer and lymphoma." Ambrosini G., Adida C., Altieri D.C. Nat. Med. 3:917-921(1997) [PubMed: 9256286] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Survivin-deltaEx3 and survivin-2B: two novel splice variants of the apoptosis inhibitor survivin with different antiapoptotic properties." Mahotka C., Wenzel M., Springer E., Gabbert H.E., Gerharz C.D. Cancer Res. 59:6097-6102(1999) [PubMed: 10626797] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY, VARIANT LYS-129. |
| [3] | "Survivin and the inner centromere protein INCENP show similar cell-cycle localization and gene knockout phenotype." Uren A.G., Wong L., Pakusch M., Fowler K.J., Burrows F.J., Vaux D.L., Choo K.H. Curr. Biol. 10:1319-1328(2000) [PubMed: 11084331] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, VARIANT LYS-129. |
| [4] | "Identification of a novel splice variant of the human anti-apoptosis gene survivin." Badran A., Yoshida A., Ishikawa K., Goi T., Yamaguchi A., Ueda T., Inuzuka M. Biochem. Biophys. Res. Commun. 314:902-907(2004) [PubMed: 14741722] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY, VARIANT LYS-129. Tissue: Myeloid leukemia cell. |
| [5] | "Molecular cloning and bioinformatics analysis of a novel spliced variant of survivin from human breast cancer cells." Zheng W., Ma X., Wei D., Wang T., Ma Y., Yang S. DNA Seq. 16:321-328(2005) [PubMed: 16329164] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), VARIANT LYS-129, TISSUE SPECIFICITY. Tissue: Mammary cancer. |
| [6] | "An isoform of survivin (survivin-beta) which has 23 amino acids insertion into the BIR domain." Kageyama H., Islam A., Takayasu H., Nakagawara A. Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT LYS-129. Tissue: Neuroblastoma. |
| [7] | "Survivin 2 alpha: a novel survivin splice variant expressed in human malignancies." Caldas H., Honsey L.E., Altura R.A. Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7). |
| [8] | "Identification of a novel survivin splicing variant 3alpha in acute myeloid leukemia." Vietri M.T., Cioffi M., Sessa M., Sica V., Molinari A.M. Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6). Tissue: Myeloid leukemia cell. |
| [9] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-129. |
| [10] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-129. |
| [11] | NIEHS SNPs program Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [12] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [13] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LYS-129. Tissue: Lung, Mammary gland and Muscle. |
| [14] | "Control of apoptosis and mitotic spindle checkpoint by survivin." Li F., Ambrosini G., Chu E.Y., Plescia J., Tognin S., Marchisio P.C., Altieri D.C. Nature 396:580-584(1998) [PubMed: 9859993] [Abstract] Cited for: FUNCTION. |
| [15] | "Regulation of apoptosis at cell division by p34cdc2 phosphorylation of survivin." O'Connor D.S., Grossman D., Plescia J., Li F., Zhang H., Villa A., Tognin S., Marchisio P.C., Altieri D.C. Proc. Natl. Acad. Sci. U.S.A. 97:13103-13107(2000) [PubMed: 11069302] [Abstract] Cited for: PHOSPHORYLATION AT THR-34. |
| [16] | "HBXIP functions as a cofactor of survivin in apoptosis suppression." Marusawa H., Matsuzawa S., Welsh K., Zou H., Armstrong R., Tamm I., Reed J.C. EMBO J. 22:2729-2740(2003) [PubMed: 12773388] [Abstract] Cited for: FUNCTION IN APOPTOSIS SUPPRESSION, INTERACTION WITH HBXIP, MUTAGENESIS OF THR-34, SUBCELLULAR LOCATION. |
| [17] | "Borealin: a novel chromosomal passenger required for stability of the bipolar mitotic spindle." Gassmann R., Carvalho A., Henzing A.J., Ruchaud S., Hudson D.F., Honda R., Nigg E.A., Gerloff D.L., Earnshaw W.C. J. Cell Biol. 166:179-191(2004) [PubMed: 15249581] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [18] | "Survivin mediates targeting of the chromosomal passenger complex to the centromere and midbody." Vader G., Kauw J.J.W., Medema R.H., Lens S.M.A. EMBO Rep. 7:85-92(2006) [PubMed: 16239925] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [19] | "Borealin/Dasra B is a cell cycle-regulated chromosomal passenger protein and its nuclear accumulation is linked to poor prognosis for human gastric cancer." Chang J.-L., Chen T.-H., Wang C.-F., Chiang Y.-H., Huang Y.-L., Wong F.-H., Chou C.-K., Chen C.-M. Exp. Cell Res. 312:962-973(2006) [PubMed: 16427043] [Abstract] Cited for: INTERACTION WITH CDCA8. |
| [20] | "EVI5 protein associates with the INCENP-aurora B kinase-survivin chromosomal passenger complex and is involved in the completion of cytokinesis." Faitar S.L., Sossey-Alaoui K |

Clusters with