Reviewed,
UniProtKB/Swiss-Prot O15519 (CFLAR_HUMAN)
Last modified
December 16, 2008.
Version 90.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: CASP8 and FADD-like apoptosis regulator Alternative name(s): Cellular FLICE-like inhibitory protein Short name=c-FLIP Caspase-eight-related protein Short name=Casper Caspase-like apoptosis regulatory protein Short name=CLARP MACH-related inducer of toxicity Short name=MRIT Caspase homolog Short name=CASH Inhibitor of FLICE Short name=I-FLICE FADD-like antiapoptotic molecule 1 Short name=FLAME-1 Usurpin Cleaved into the following 2 chains: 1- Recommended name: CASP8 and FADD-like apoptosis regulator subunit p43 2- Recommended name: CASP8 and FADD-like apoptosis regulator subunit p12 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 480 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity. Ref.14 |
| Subunit structure | TNFRSF6 stimulation triggers recruitment to the death-inducing signaling complex (DISC) formed by TNFRSF6, FADD and caspase-8. A proteolytic fragment (p43) stays associated with the DISC. Also interacts with caspase-10, caspase-3, TRAF1, TRAF2 and Bcl-X(L) (in vitro). Interacts with HBV protein X. Ref.7 |
| Tissue specificity | Widely expressed. Higher expression in skeletal muscle, pancreas, heart, kidney, placenta, and peripheral blood leukocytes. Also detected in diverse cell lines. Isoform 8 is predominantly expressed in testis and skeletal muscle. |
| Induction | Repressed by IL-2 after TCR stimulation, during progression to the S-phase of the cell cycle. Ref.15 |
| Domain | The caspase domain lacks the active sites residues involved in catalysis. |
| Post-translational modification | Proteolytically processed; probably by caspase-8. Processing likely occurs at the DISC and generates subunit p43 and p12. |
| Sequence similarities | Belongs to the peptidase C14A family. Contains 2 DED (death effector) domains. |
Ontologies
Keywords | |
|---|---|
| Biological process | Apoptosis Host-virus interaction |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
Gene Ontology (GO) | |
| Biological process | anti-apoptosis Ref.3 Traceable author statement. Source: ProtInc induction of apoptosis by extracellular signals Ref.1Traceable author statement. Source: ProtInc interspecies interaction between organismsInferred from electronic annotation. Source: UniProtKB-KW positive regulation of I-kappaB kinase/NF-kappaB cascadeInferred from expression pattern. Source: UniProtKB proteolysisInferred from electronic annotation. Source: InterPro |
| Molecular function | cysteine-type endopeptidase activity Inferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DOK2 | O60496 | 1 | EBI-514941,EBI-1046024 | |
| SF3B3 | Q15393 | 1 | EBI-514941,EBI-346977 |
Alternative products
| This entry describes 14 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O15519-1) Also known as: FLIP-L; CLARP1; MRIT alpha-1; CASH alpha; I-FLICE 1; FLAME-1 gamma; Usurpin alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O15519-2) Also known as: FLIP-S; CLARP2; MRIT beta-1; CASH beta; The sequence of this isoform differs from the canonical sequence as follows: 203-221: LHNGRSKEQRLKEQLGAQQ → MITPYAHCPDLKILGNCSM 222-480: Missing. | ||||||
| Isoform 3 (identifier: O15519-3) Also known as: MRIT alpha-2; The sequence of this isoform differs from the canonical sequence as follows: 1-96: Missing. 436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL | ||||||
| Isoform 4 (identifier: O15519-4) Also known as: I-FLICE 2; The sequence of this isoform differs from the canonical sequence as follows: 1-245: Missing. | ||||||
| Isoform 5 (identifier: O15519-5) Also known as: I-FLICE 3; The sequence of this isoform differs from the canonical sequence as follows: 449-480: YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → L | ||||||
| Isoform 6 (identifier: O15519-6) Also known as: I-FLICE 4; The sequence of this isoform differs from the canonical sequence as follows: 2-30: SAEVIHQVEEALDTDEKEMLLFLCRDVAI → LERPPVCSKV 453-480: WNSRVSAKEKYYVWLQHTLRKKLILSYT → SLEHTGGRY | ||||||
| Isoform 7 (identifier: O15519-7) Also known as: I-FLICE 5; The sequence of this isoform differs from the canonical sequence as follows: 1-96: Missing. 203-221: LHNGRSKEQRLKEQLGAQQ → E 436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL | ||||||
| Isoform 8 (identifier: O15519-8) Also known as: FLAME-1 alpha; The sequence of this isoform differs from the canonical sequence as follows: 203-237: Missing. | ||||||
| Isoform 9 (identifier: O15519-9) Also known as: FLAME-1 beta; The sequence of this isoform differs from the canonical sequence as follows: 203-237: Missing. 267-305: LRDTFTSLGY...FACMPEHRDY → CGVRGPAGGQ...ARAVHSSPRS 306-480: Missing. | ||||||
| Notes: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 10 (identifier: O15519-10) Also known as: FLAME-1 delta; The sequence of this isoform differs from the canonical sequence as follows: 266-300: LLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP → NAHSWIFTLNSMATCMIGTAEFLPRRNIMFGCSTL 301-480: Missing. | ||||||
| Isoform 11 (identifier: O15519-11) Also known as: Usurpin beta; The sequence of this isoform differs from the canonical sequence as follows: 436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL | ||||||
| Isoform 12 (identifier: O15519-12) Also known as: Usurpin gamma; The sequence of this isoform differs from the canonical sequence as follows: 265-292: ELLRDTFTSLGYEVQKFLHLSMHGISQI → GWSAMAQSQLTAISTSQVQAILLPQPPE 293-480: Missing. | ||||||
| Isoform 13 (identifier: O15519-13) The sequence of this isoform differs from the canonical sequence as follows: 203-480: Missing. | ||||||
| Isoform 14 (identifier: O15519-14) The sequence of this isoform differs from the canonical sequence as follows: 436-480: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 376 | 376 | CASP8 and FADD-like apoptosis regulator subunit p43 | PRO_0000004678 | |||||
| Chain | 377 – 480 | 104 | CASP8 and FADD-like apoptosis regulator subunit p12 Potential | PRO_0000004679 | |||||
Regions | |||||||||
| Domain | 1 – 73 | 73 | DED 1 | ||||||
| Domain | 92 – 170 | 79 | DED 2 | ||||||
| Region | 1 – 435 | 435 | Not proteolytically processed and involved in apoptosis inhibition | ||||||
| Region | 1 – 305 | 305 | Interaction with caspase-8 propeptide | ||||||
| Region | 1 – 227 | 227 | Interaction with FADD | ||||||
| Region | 1 – 195 | 195 | Interaction with caspase-8 | ||||||
| Region | 192 – 480 | 289 | Interaction with TRAF1 and TRAF2 | ||||||
| Region | 192 – 435 | 244 | Interaction with caspase-3 | ||||||
| Region | 217 – 480 | 264 | Interaction with caspase-8 subunits p18 and p10 | ||||||
| Region | 263 – 358 | 96 | Caspase | ||||||
| Region | 370 – 480 | 111 | Interaction with caspase-8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 245 | 245 | Missing in isoform 4. | VSP_000825 | |||||
| Alternative sequence | 1 – 96 | 96 | Missing in isoform 7 and isoform 3. | VSP_000824 | |||||
| Alternative sequence | 2 – 30 | 29 | SAEVI…RDVAI → LERPPVCSKV in isoform 6. | VSP_000826 | |||||
| Alternative sequence | 203 – 480 | 278 | Missing in isoform 13. | VSP_000831 | |||||
| Alternative sequence | 203 – 237 | 35 | Missing in isoform 8 and isoform 9. | VSP_000830 | |||||
| Alternative sequence | 203 – 221 | 19 | LHNGR…LGAQQ → MITPYAHCPDLKILGNCSM in isoform 2. | VSP_000828 | |||||
| Alternative sequence | 203 – 221 | 19 | LHNGR…LGAQQ → E in isoform 7. | VSP_000827 | |||||
| Alternative sequence | 222 – 480 | 259 | Missing in isoform 2. | VSP_000829 | |||||
| Alternative sequence | 265 – 292 | 28 | ELLRD…GISQI → GWSAMAQSQLTAISTSQVQA ILLPQPPE in isoform 12. | VSP_000832 | |||||
| Alternative sequence | 266 – 300 | 35 | LLRDT…FACMP → NAHSWIFTLNSMATCMIGTA EFLPRRNIMFGCSTL in isoform 10. | VSP_000834 | |||||
| Alternative sequence | 267 – 305 | 39 | LRDTF…EHRDY → CGVRGPAGGQQPLGGGWASD EECGIQGSEARAVHSSPRS in isoform 9. | VSP_000836 | |||||
| Alternative sequence | 293 – 480 | 188 | Missing in isoform 12. | VSP_000833 | |||||
| Alternative sequence | 301 – 480 | 180 | Missing in isoform 10. | VSP_000835 | |||||
| Alternative sequence | 306 – 480 | 175 | Missing in isoform 9. | VSP_000837 | |||||
| Alternative sequence | 436 – 480 | 45 | KRPLL…ILSYT → GTIPGSGITESKDMHFSSLG CILLDVL in isoform 11, isoform 7 and isoform 3. | VSP_000838 | |||||
| Alternative sequence | 436 – 480 | 45 | Missing in isoform 14. | VSP_000839 | |||||
| Alternative sequence | 449 – 480 | 32 | YMYDW…ILSYT → L in isoform 5. | VSP_000840 | |||||
| Alternative sequence | 453 – 480 | 28 | WNSRV…ILSYT → SLEHTGGRY in isoform 6. | VSP_000841 | |||||
| Natural variant | 203 | 1 | L → I: dbSNP rs13424615. | VAR_048619 | |||||
Experimental info | |||||||||
| Mutagenesis | 360 | 1 | Y → F: Decreases apoptosis-inducing activity. Reduces interaction with caspase-3 and proteolytic processing Ref.1 | ||||||
| Mutagenesis | 376 | 1 | D → N or A: Abolishes proteolytic processing Ref.4 | ||||||
| Sequence conflict | 130 – 132 | 3 | SFL → ISW in AAC15826 and AAC15825. Ref.9 | ||||||
| Sequence conflict | 343 | 1 | D → E in AAC15825. Ref.9 | ||||||
| Sequence conflict | 364 | 1 | E → D in AAB99794. Ref.6 | ||||||
| Sequence conflict | 366 – 368 | 3 | QLE → PAG in AAC15825. Ref.9 | ||||||
| Sequence conflict | 369 | 1 | D → N in CAA74366. Ref.8 | ||||||
| Sequence conflict | 372 | 1 | L → F in AAB99793. Ref.6 | ||||||
| Sequence conflict | 373 – 374 | 2 | LE → WR in AAC15825. Ref.9 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||

Clusters with