Reviewed,
UniProtKB/Swiss-Prot O43184 (ADA12_HUMAN)
Last modified
December 16, 2008.
Version 91.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: ADAM 12 EC=3.4.24.- Alternative name(s): A disintegrin and metalloproteinase domain 12 Meltrin-alpha | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 909 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors By similarity. |
| Cofactor | Binds 1 zinc ion per subunit. |
| Subunit structure | Interacts with alpha-actinin-2 and with syndecans By similarity. Interacts with SH3PXD2A. |
| Subcellular location | Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2: Secreted. Isoform 3: SecretedPotential. Isoform 4: SecretedPotential. |
| Tissue specificity | Isoform 1 is expressed in placenta and skeletal, cardiac, and smooth muscle. Isoform 2 seems to be expressed only in placenta or in embryo and fetus. Both forms were expressed in some tumor cells lines. Not detected in brain, lung, liver, kidney or pancreas. |
| Domain | The cysteine-rich domain supports cell adhesion through syndecans and triggers signaling events that lead to beta-1 integrin-dependent cell spreading. In carcinomas cells the binding of this domain to syndecans does not allow the integrin-mediated cell spreading. The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. |
| Post-translational modification | The precursor is cleaved by a furin endopeptidase By similarity. |
| Sequence similarities | Contains 1 disintegrin domain. Contains 1 EGF-like domain. Contains 1 peptidase M12B domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43184-1) Also known as: 12L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43184-2) Also known as: 12S; The sequence of this isoform differs from the canonical sequence as follows: 705-738: DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLL → EARQEAAESNRERGQGQEPVGSQEHASTASLTLI 739-909: Missing. | ||||||
| Isoform 3 (identifier: O43184-3) The sequence of this isoform differs from the canonical sequence as follows: 114-116: Missing. 705-738: DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLL → EARQEAAESNRERGQGQEPVGSQEHASTASLTLI 739-909: Missing. | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O43184-4) The sequence of this isoform differs from the canonical sequence as follows: 114-116: Missing. 705-740: DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLLFT → GKEARQEAAESNRERGQGQEPVGSQEHASTASLTLI 741-909: Missing. | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | Potential | ||||||||
| Propeptide | 29 – 207 | 179 | By similarity | PRO_0000029078 | |||||||
| Chain | 208 – 909 | 702 | ADAM 12 | PRO_0000029079 | |||||||
Regions | |||||||||||
| Topological domain | 208 – 708 | 501 | Extracellular Potential | ||||||||
| Transmembrane | 709 – 729 | 21 | Potential | ||||||||
| Topological domain | 730 – 909 | 180 | Cytoplasmic Potential | ||||||||
| Domain | 214 – 416 | 203 | Peptidase M12B | ||||||||
| Domain | 424 – 510 | 87 | Disintegrin | ||||||||
| Domain | 656 – 688 | 33 | EGF-like | ||||||||
| Motif | 177 – 184 | 8 | Cysteine switch By similarity | ||||||||
| Motif | 828 – 834 | 7 | SH3-binding; class II By similarity | ||||||||
| Motif | 834 – 841 | 8 | SH3-binding; class I By similarity | ||||||||
| Motif | 885 – 891 | 7 | SH3-binding; class I By similarity | ||||||||
| Compositional bias | 514 – 649 | 136 | Cys-rich | ||||||||
Sites | |||||||||||
| Active site | 351 | 1 | |||||||||
| Metal binding | 179 | 1 | Zinc; in inhibited form By similarity | ||||||||
| Metal binding | 350 | 1 | Zinc; catalytic | ||||||||
| Metal binding | 354 | 1 | Zinc; catalytic | ||||||||
| Metal binding | 360 | 1 | Zinc; catalytic | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 907 | 1 | Phosphotyrosine; by SRC By similarity | ||||||||
| Glycosylation | 111 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 149 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 381 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 452 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 651 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 325 ↔ 411 | By similarity | |||||||||
| Disulfide bond | 367 ↔ 395 | By similarity | |||||||||
| Disulfide bond | 369 ↔ 378 | By similarity | |||||||||
| Disulfide bond | 482 ↔ 502 | By similarity | |||||||||
| Disulfide bond | 660 ↔ 670 | By similarity | |||||||||
| Disulfide bond | 664 ↔ 676 | By similarity | |||||||||
| Disulfide bond | 678 ↔ 687 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 114 – 116 | 3 | Missing in isoform 3 and isoform 4. | VSP_031001 | |||||||
| Alternative sequence | 705 – 740 | 36 | DNQGL…RLLFT → GKEARQEAAESNRERGQGQE PVGSQEHASTASLTLI in isoform 4. | VSP_031002 | |||||||
| Alternative sequence | 705 – 738 | 34 | DNQGL…LIRLL → EARQEAAESNRERGQGQEPV GSQEHASTASLTLI in isoform 2 and isoform 3. | VSP_005476 | |||||||
| Alternative sequence | 739 – 909 | 171 | Missing in isoform 2 and isoform 3. | VSP_005477 | |||||||
| Alternative sequence | 741 – 909 | 169 | Missing in isoform 4. | VSP_031003 | |||||||
| Natural variant | 48 | 1 | R → G: dbSNP rs3740199. Ref.4 | VAR_038542 | |||||||
| Natural variant | 301 | 1 | D → H in a breast cancer sample; somatic mutation. Ref.10 | VAR_036143 | |||||||
| Natural variant | 479 | 1 | G → E in a breast cancer sample; somatic mutation. Ref.10 | VAR_036144 | |||||||
| Natural variant | 792 | 1 | L → F in a breast cancer sample; somatic mutation. Ref.10 | VAR_036145 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel, secreted form of human ADAM 12 (meltrin alpha) provokes myogenesis in vivo." Gilpin B.J., Loechel F., Mattei M.-G., Engvall E., Albrechtsen R., Wewer U.M. J. Biol. Chem. 273:157-166(1998) [PubMed: 9417060] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Placenta. |
| [2] | Gilpin B.J., Loechel F., Mattei M.-G., Engvall E., Albrechtsen R., Wewer U.M. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO 36. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLY-48. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Placenta. |
| [7] | "Human ADAM 12 (meltrin alpha) is an active metalloprotease." Loechel F., Gilpin B.J., |

Clusters with