Reviewed,
UniProtKB/Swiss-Prot O43251 (RBM9_HUMAN)
Last modified
December 16, 2008.
Version 87.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: RNA-binding protein 9 Alternative name(s): RNA-binding motif protein 9 Fox-1 homolog B Hexaribonucleotide-binding protein 2 Repressor of tamoxifen transcriptional activity | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 390 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis By similarity. RNA-binding protein that seems to act as a coregulatory factor of ER-alpha. |
| Subunit structure | Interacts with ER-alpha N-terminal activation domain. |
| Subcellular location | |
| Sequence similarities | Contains 1 RRM (RNA recognition motif) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN1 | P54253 | 1 | EBI-746056,EBI-930964 | |
| FOX1 | Q9NWB1 | 1 | EBI-746056,EBI-945906 | |
| QKI | Q96PU8 | 1 | EBI-746056,EBI-945792 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O43251-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O43251-2) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT 94-94: T → TQ | ||||||
| Isoform 3 (identifier: O43251-3) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT 143-160: Missing. 261-265: SLPLV → I | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O43251-4) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT 311-390: VYQDGFYGAD...RGGYSRFAPY → DMQPTDMHSL...TADLPPTEVT | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: O43251-5) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT 261-265: SLPLV → I | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: O43251-6) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAEGAQPQQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM | ||||||
| Isoform 7 (identifier: O43251-7) The sequence of this isoform differs from the canonical sequence as follows: 261-265: SLPLV → I 323-390: GGYAAYRYAQ...RGGYSRFAPY → IESANCFRSN...TADLPPTEVT | ||||||
| Isoform 8 (identifier: O43251-8) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAEGAQPQQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM 94-94: T → TQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 390 | 390 | RNA-binding protein 9 | PRO_0000081766 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Domain | 121 – 197 | 77 | RRM | |||||||||||||||||||||
| Compositional bias | 273 – 377 | 105 | Ala-rich | |||||||||||||||||||||
Sites | ||||||||||||||||||||||||
| Site | 122 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 130 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 131 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 155 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 160 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 164 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 188 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
| Site | 198 | 1 | Interaction with RNA By similarity | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 1 – 18 | 18 | MQNEP…PARDS → MEKKKMVT in isoform 2, isoform 3, isoform 4 and isoform 5. | VSP_007180 | ||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MAEGAQPQQPPQLGPGAAAR GMKRESELELPVPGAGGDGA DPGLSKRPRTEEAAADGGGG M in isoform 6 and isoform 8. | VSP_030889 | ||||||||||||||||||||
| Alternative sequence | 94 | 1 | T → TQ in isoform 2 and isoform 8. | VSP_030890 | ||||||||||||||||||||
| Alternative sequence | 143 – 160 | 18 | Missing in isoform 3. | VSP_007181 | ||||||||||||||||||||
| Alternative sequence | 261 – 265 | 5 | SLPLV → I in isoform 3, isoform 5 and isoform 7. | VSP_007182 | ||||||||||||||||||||
| Alternative sequence | 311 – 390 | 80 | VYQDG…RFAPY → DMQPTDMHSLLLQPQPPLLQ PLQPLTVTVMAGCTQPTPTM PLPLPLAMELALWRVYTEVA TADLPPTEVT in isoform 4. | VSP_007183 | ||||||||||||||||||||
| Alternative sequence | 323 – 390 | 68 | GGYAA…RFAPY → IESANCFRSNRVDMQPTDMH SLLLQPQPPLLQPLQPLTVT VMAGCTQPTPTMPLPLPLAM ELALWRVYTEVATADLPPTE VT in isoform 7. | VSP_030891 | ||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||
| Sequence conflict | 116 | 1 | S → G in AAX84843. Ref.6 | |||||||||||||||||||||
| Sequence conflict | 231 | 1 | S → F in BAB70875. Ref.4 | |||||||||||||||||||||
| Sequence conflict | 346 | 1 | A → V in AAH13115. Ref.8 | |||||||||||||||||||||
| Sequence conflict | 350 | 1 | S → G in BAB70875. Ref.4 | |||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Beta strand | 122 – 127 | 6 | ||||||||||||||||||||||
| Helix | 134 – 140 | 7 | ||||||||||||||||||||||
| Helix | 141 – 143 | 3 | ||||||||||||||||||||||
| Beta strand | 147 – 153 | 7 | ||||||||||||||||||||||
| Turn | 156 – 159 | 4 | ||||||||||||||||||||||
| Beta strand | 162 – 168 | 7 | ||||||||||||||||||||||
| Helix | 170 – 180 | 11 | ||||||||||||||||||||||
| Beta strand | 191 – 194 | 4 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A negative coregulator for the human ER." Norris J.D., Fan D., Sherk A., McDonnell D.P. Mol. Endocrinol. 16:459-468(2002) [PubMed: 11875103] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Reevaluating human gene annotation: a second-generation analysis of chromosome 22." Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I. Genome Res. 13:27-36(2003) [PubMed: 12529303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Placenta. |
| [3] | Chen W., Winkelmann J.C. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 6). Tissue: Brain. |
| [5] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:RESEARCH84.1-RESEARCH84.11(2004) [PubMed: 15461802] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). |
| [6] | "A novel isoform of RNA binding motif protein 9." Yang G., Huang S.C., Benz E.J. Jr. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [7] | Zhou G., Nong W., Li H., Ke R., Shen C., Liang M., Tang Z., Huang B., Lin L., Yang S. Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8). |
| [8] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. |

Clusters with