Reviewed,
UniProtKB/Swiss-Prot O70293 (GRK6_MOUSE)
Last modified
July 22, 2008.
Version 84.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: G protein-coupled receptor kinase 6 EC=2.7.11.16 Alternative name(s): G protein-coupled receptor kinase GRK6 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 576 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Specifically phosphorylates the activated forms of G protein-coupled receptors By similarity. |
| Catalytic activity | ATP + [G-protein-coupled receptor] = ADP + [G-protein-coupled receptor] phosphate. |
| Subcellular location | |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily. Contains 1 AGC-kinase C-terminal domain. Contains 1 protein kinase domain. Contains 1 RGS domain. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Lipoprotein Palmitate Phosphoprotein |
Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform GRK6A (identifier: O70293-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform GRK6B (identifier: O70293-2) The sequence of this isoform differs from the canonical sequence as follows: 560-576: DCCGNCSDSEEELPTRL → RIAVGTAATVRKSSPPASSPQAEAPTGGWR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 576 | 576 | G protein-coupled receptor kinase 6 | |||||
Regions | ||||||||
| Domain | 53 – 171 | 119 | RGS | |||||
| Domain | 186 – 448 | 263 | Protein kinase | |||||
| Domain | 449 – 514 | 66 | AGC-kinase C-terminal | |||||
| Nucleotide binding | 192 – 200 | 9 | ATP By similarity | |||||
| Region | 1 – 185 | 185 | N-terminal | |||||
Sites | ||||||||
| Active site | 311 | 1 | Proton acceptor By similarity | |||||
| Binding site | 215 | 1 | ATP By similarity | |||||
Amino acid modifications | ||||||||
| Modified residue | 484 | 1 | Phosphoserine; by autocatalysis By similarity | |||||
| Modified residue | 485 | 1 | Phosphothreonine; by autocatalysis By similarity | |||||
| Lipidation | 561 | 1 | S-palmitoyl cysteine By similarity | |||||
| Lipidation | 562 | 1 | S-palmitoyl cysteine By similarity | |||||
| Lipidation | 565 | 1 | S-palmitoyl cysteine By similarity | |||||
Natural variations | ||||||||
| Alternative sequence | 560 – 576 | 17 | DCCGN…LPTRL → RIAVGTAATVRKSSPPASSP QAEAPTGGWR in isoform GRK6B. | |||||
Experimental info | ||||||||
| Sequence conflict | 98 | 1 | R → Q in AAC09265. Ref.1 | |||||
| Sequence conflict | 571 | 1 | E → K in AAC09265. Ref.1 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The GRK4 subfamily of G protein-coupled receptor kinases. Alternative splicing, gene organization, and sequence conservation." Premont R.T., Macrae A.D., Aparicio S.A., Kendall H.E., Welch J.E., Lefkowitz R.J. J. Biol. Chem. 274:29381-29389(1999) [PubMed: 10506199] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS GRK6A AND GRK6B). Strain: 129/SvJ. |
| [2] | "Primary structure of murine G-protein-coupled receptor kinase 6 splice variants predict differential regulation by posttranslational modifications." Moepps B., Vatter P., Frode R., Waechter F., Gierschik P. Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS GRK6A AND GRK6B). Strain: 129/SvJ and C57BL/6J. Tissue: Thymus. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF040747 mRNA. Translation: AAC09268.1. AF040748 mRNA. Translation: AAC09269.1. AF040749 mRNA. Translation: AAC09270.1. AF040754 Genomic DNA. Translation: AAC09265.1. Y17967 Genomic DNA. Translation: CAA76975.1. Y17967 Genomic DNA. Translation: CAA76976.1. Y15798 mRNA. Translation: CAA75789.1. Y15799 mRNA. Translation: CAA75790.1. | |
| RefSeq | NP_001033107.1. NP_001106182.1. NP_036068.2. |
| UniGene | Mm.10193 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1GZK based on UniProtKB P31751. |
| SMR | O70293. Positions 23-532. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | O70293. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000074886. Mus musculus. [Contig view] |
| GeneID | 26385. |
| KEGG | mmu:26385. |
Organism-specific databases | |
| MGI | MGI:1347078. Grk6. |
Phylogenomic databases | |
| HOVERGEN | O70293. |
Gene expression databases | |
| ArrayExpress | O70293. |
| CleanEx | MM_GRK6. |
| GermOnline | ENSMUSG00000074886. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000239. GPCR_kinase. IPR000961. Pkinase_C. IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_bd_CS. IPR000342. Regulat_G_prot_signal. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. PF00615. RGS. 1 hit. [Graphical view] |
| PRINTS | PR00717. GPCRKINASE. |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00315. RGS. 1 hit. SM00133. S_TK_X. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS51285. AGC_KINASE_CTER. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. PS50132. RGS. 1 hit. [Graphical view] |
| BLOCKS | Search... |
Other Resources | |
| SOURCE | Search... |
| ProtoNet | Search... |
Entry information
| Entry name | GRK6_MOUSE | ||||||||
| Accession | Primary (citable) accession number: O70293 Secondary accession number(s): O70294, O70295 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


