Reviewed,
UniProtKB/Swiss-Prot O75363 (BCAS1_HUMAN)
Last modified
December 16, 2008.
Version 57.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Breast carcinoma-amplified sequence 1 Alternative name(s): Novel amplified in breast cancer 1 Amplified and overexpressed in breast cancer | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 584 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subunit structure | Homodimer. May interact with DYNLL1 and DYNLL2 By similarity. |
| Subcellular location | |
| Tissue specificity | Expressed in brain and prostate, and at lower levels in testis, intestine and colon. Overexpressed in most breast cancer cell lines and down-regulated in some colorectal tumors. Ref.6 Ref.4 |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DYNLL1 | P63167 | 1 | EBI-1042966,EBI-349105 | |
| RUVBL2 | Q9Y230 | 1 | EBI-1042966,EBI-352939 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O75363-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O75363-2) Also known as: 5B; The sequence of this isoform differs from the canonical sequence as follows: 309-309: T → TASKAESVCDGQAGQKTSEIQARGTKKKHLDSPRLGLAFRKFFRHK 381-394: Missing. 451-472: Missing. 584-584: K → KYTGKCVFSHVKKKWPFQEWSY | ||||||
| Notes: May be phosphorylated on Ser-340. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 584 | 584 | Breast carcinoma-amplified sequence 1 | PRO_0000064859 | |||||
Natural variations | |||||||||
| Alternative sequence | 309 | 1 | T → TASKAESVCDGQAGQKTSEI QARGTKKKHLDSPRLGLAFR KFFRHK in isoform 2. | VSP_018520 | |||||
| Alternative sequence | 381 – 394 | 14 | Missing in isoform 2. | VSP_018521 | |||||
| Alternative sequence | 451 – 472 | 22 | Missing in isoform 2. | VSP_018522 | |||||
| Alternative sequence | 584 | 1 | K → KYTGKCVFSHVKKKWPFQEW SY in isoform 2. | VSP_018523 | |||||
| Natural variant | 24 | 1 | Q → K: dbSNP rs394732. | VAR_026674 | |||||
| Natural variant | 163 | 1 | V → A: dbSNP rs158551. | VAR_026675 | |||||
| Natural variant | 255 | 1 | G → E: dbSNP rs6022903. | VAR_024251 | |||||
| Natural variant | 472 | 1 | Q → H: dbSNP rs35575210. | VAR_050691 | |||||
| Natural variant | 583 | 1 | S → P: dbSNP rs1055246. Ref.1 | VAR_026676 | |||||
Experimental info | |||||||||
| Sequence conflict | 361 | 1 | G → D in CAH18437. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Positional cloning of ZNF217 and NABC1: genes amplified at 20q13.2 and overexpressed in breast carcinoma." Collins C., Rommens J.M., Kowbel D., Godfrey T., Tanner M., Hwang S.-I., Polikoff D., Nonet G., Cochran J., Myambo K., Jay K.E., Froula J., Cloutier T., Kuo W.-L., Yaswen P., Dairkee S., Giovanola J., Hutchinson G.B. Gray J.W.Proc. Natl. Acad. Sci. U.S.A. 95:8703-8708(1998) [PubMed: 9671742] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT PRO-583. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "NABC1 (BCAS1): alternative splicing and downregulation in colorectal tumors." Correa R.G., de Carvalho A.F., Pinheiro N.A., Simpson A.J.G., de Souza S.J. Genomics 65:299-302(2000) [PubMed: 10857754] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 264-330 (ISOFORM 2), TISSUE SPECIFICITY. |
| [5] | The German cDNA consortium Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 275-584 (ISOFORM 2). Tissue: Amygdala. |
| [6] | "Characterization of the novel amplified in breast cancer-1 (NABC1) gene product." Beardsley D.I., Kowbel D., Lataxes T.A., Mannino J.M., Xin H., Kim W.-J., Collins C., Brown K.D. Exp. Cell Res. 290:402-413(2003) [PubMed: 14567997] [Abstract] Cited for: SUBUNIT, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF041260 mRNA. Translation: AAC39896.1. AC004501 Genomic DNA. No translation available. AC005220 Genomic DNA. No translation available. BC126346 mRNA. Translation: AAI26347.1. AI904532 mRNA. No translation available. CR749643 mRNA. Translation: CAH18437.1. | |
| RefSeq | NP_003648.2. |
| UniGene | Hs.400556 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O75363. 2 interactions. |
PTM databases | |
| PhosphoSite | O75363. |
Proteomic databases | |
| PRIDE | O75363. |
Genome annotation databases | |
| Ensembl | ENSG00000064787. Homo sapiens. [Contig view] |
| GeneID | 8537. |
| KEGG | hsa:8537. |
| NMPDR | fig|9606.3.peg.20494. |
Organism-specific databases | |
| GeneCards | GC20M051993. |
| HGNC | HGNC:974. BCAS1. |
| MIM | 602968. gene. |
| PharmGKB | PA25284. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | O75363. |
| HOVERGEN | O75363. |
Gene expression databases | |
| ArrayExpress | O75363. |
| CleanEx | HS_BCAS1. |
| GermOnline | ENSG00000064787. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 31976. |
| SOURCE | Search... |
Entry information
| Entry name | BCAS1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75363 Secondary accession number(s): A0AVG5, Q68CZ3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with


