Reviewed,
UniProtKB/Swiss-Prot O76083 (PDE9A_HUMAN)
Last modified
July 22, 2008.
Version 76.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A EC=3.1.4.35 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 593 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase has a high affinity for cGMP. |
| Catalytic activity | Guanosine 3',5'-cyclic phosphate + H(2)O = guanosine 5'-phosphate. |
| Cofactor | Divalent cations. Preferably manganese. |
| Enzyme regulation | Inhibited by zaprinast. |
| Tissue specificity | Expressed in all tissues examined (testis, brain, small intestine, skeletal muscle, heart, lung, thymus, spleen, placenta, kidney, liver, pancreas, ovary and prostate) except blood. Highest levels in brain, heart, kidney, spleen, prostate and colon. Isoform PDE9A12 is found in prostate. |
| Domain | Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain. |
| Involvement in disease | May be involved in affective bipolar disorder. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. |
Ontologies
Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Manganese Metal-binding cGMP |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
Gene Ontology (GO) | |
| Biological process | signal transduction Ref.2 Traceable author statement. Source: ProtInc |
| Cellular component | cytoplasm Inferred from direct assay. Source: UniProtKB |
| Molecular function | 3',5'-cyclic-nucleotide phosphodiesterase activity Ref.2 Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 15 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform PDE9A1 (identifier: O76083-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform PDE9A2 (identifier: O76083-2) The sequence of this isoform differs from the canonical sequence as follows: 88-147: Missing. | |||||
| Isoform PDE9A3 (identifier: O76083-3) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS 88-147: Missing. | |||||
| Isoform PDE9A4 (identifier: O76083-4) The sequence of this isoform differs from the canonical sequence as follows: 24-165: VIFSKYCNSS...VLAQVAEQFS → HSVQSETCGHQATL | |||||
| Isoform PDE9A5 (identifier: O76083-5) The sequence of this isoform differs from the canonical sequence as follows: 74-165: TPYKVRPVAI...VLAQVAEQFS → NELILYTSLR...SETCGHQATL | |||||
| Isoform PDE9A6 (identifier: O76083-6) Also known as: PDE9A5; The sequence of this isoform differs from the canonical sequence as follows: 1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR 88-147: Missing. | |||||
| Isoform PDE9A7/A8/A14/A19/A20 (identifier: O76083-7) The sequence of this isoform differs from the canonical sequence as follows: 1-207: Missing. | |||||
| Isoform PDE9A9 (identifier: O76083-8) The sequence of this isoform differs from the canonical sequence as follows: 48-73: Missing. 88-147: Missing. | |||||
| Isoform PDE9A10 (identifier: O76083-9) The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 161-165: AEQFS → MDAFR | |||||
| Isoform PDE9A11/A15 (identifier: O76083-10) The sequence of this isoform differs from the canonical sequence as follows: 1-217: Missing. 218-218: R → M | |||||
| Isoform PDE9A12 (identifier: O76083-11) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR 73-165: Missing. | |||||
| Isoform PDE9A13 (identifier: O76083-12) The sequence of this isoform differs from the canonical sequence as follows: 24-165: VIFSKYCNSS...VLAQVAEQFS → EHDHLPADHR...SETCGHQATL | |||||
| Isoform PDE9A16 (identifier: O76083-13) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MGSGSSSYRP...DPTMPANSER → MDAFRS | |||||
| Isoform PDE9A17 (identifier: O76083-14) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLP → MDAFR | |||||
| Isoform PDE9A18 (identifier: O76083-15) The sequence of this isoform differs from the canonical sequence as follows: 48-73: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 593 | 593 | High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 288 – 550 | 263 | Catalytic By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 312 | 1 | Manganese 1 Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 316 | 1 | Manganese 1 Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 341 | 1 | Manganese 1 Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 352 | 1 | Manganese 2 Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 356 | 1 | Manganese 2 Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 382 | 1 | Manganese 2 Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 29 | 1 | Phosphotyrosine | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 217 | 217 | Missing in isoform PDE9A11/A15. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 207 | 207 | Missing in isoform PDE9A7/A8/A14/A19/A20. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 160 | 160 | Missing in isoform PDE9A10. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 73 | 73 | MGSGS…ANSER → MDAFRS in isoform PDE9A3 and isoform PDE9A16. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 46 | 46 | MGSGS…ATGLP → MDAFR in isoform PDE9A6, isoform PDE9A12 and isoform PDE9A17. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 24 – 165 | 142 | VIFSK…AEQFS → EHDHLPADHRRRHGLHRPHH AREFRTHSVQSETCGHQATL in isoform PDE9A13. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 24 – 165 | 142 | VIFSK…AEQFS → HSVQSETCGHQATL in isoform PDE9A4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 48 – 73 | 26 | Missing in isoform PDE9A9 and isoform PDE9A18. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 73 – 165 | 93 | Missing in isoform PDE9A12. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 74 – 165 | 92 | TPYKV…AEQFS → NELILYTSLRNLLFLPSKES WASHQHSVQSETCGHQATL in isoform PDE9A5. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 88 – 147 | 60 | Missing in isoform PDE9A2, isoform PDE9A3, isoform PDE9A6 and isoform PDE9A9. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 161 – 165 | 5 | AEQFS → MDAFR in isoform PDE9A10. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 218 | 1 | R → M in isoform PDE9A11/A15. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 250 – 255 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 268 – 281 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 287 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 292 – 304 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 310 – 313 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 314 – 330 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 336 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 339 – 351 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 352 – 355 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 361 – 366 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 370 – 374 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 375 – 377 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 380 – 393 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 396 – 398 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 400 – 403 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 406 – 421 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 425 – 427 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 428 – 438 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 439 – 441 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 447 – 462 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 465 – 467 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 470 – 493 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 500 – 502 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 504 – 506 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 509 – 519 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 521 – 531 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 535 – 560 | 26 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||

Clusters with