Reviewed,
UniProtKB/Swiss-Prot O94929 (ABLM3_HUMAN)
Last modified
November 25, 2008.
Version 71.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Actin-binding LIM protein 3 Alternative name(s): Actin-binding LIM protein family member 3 Short name=abLIM-3 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 683 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity. |
| Subunit structure | Directly interacts with F-actin and ABRA. |
| Subcellular location | CytoplasmBy similarity. |
| Tissue specificity | Expressed predominantly in heart and brain. |
| Sequence similarities | Contains 1 HP (headpiece) domain. Contains 4 LIM zinc-binding domains. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | LIM domain Repeat |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
Gene Ontology (GO) | |
| Biological process | cytoskeleton organization Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Non-traceable author statement. Source: UniProtKB |
| Molecular function | actin binding Inferred from electronic annotation. Source: InterPro zinc ion bindingNon-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94929-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94929-2) The sequence of this isoform differs from the canonical sequence as follows: 297-358: Missing. 402-450: Missing. 647-683: RHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF → GNFWKSGCL | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: O94929-3) The sequence of this isoform differs from the canonical sequence as follows: 297-358: Missing. 402-434: Missing. | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: O94929-4) The sequence of this isoform differs from the canonical sequence as follows: 1-514: Missing. | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||
Molecule processing | ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 683 | 683 | Actin-binding LIM protein 3 | PRO_0000075702 | ||||||||||||||||||
Regions | ||||||||||||||||||||||
| Domain | 21 – 80 | 60 | LIM zinc-binding 1 | |||||||||||||||||||
| Domain | 80 – 140 | 61 | LIM zinc-binding 2 | |||||||||||||||||||
| Domain | 149 – 208 | 60 | LIM zinc-binding 3 | |||||||||||||||||||
| Domain | 208 – 268 | 61 | LIM zinc-binding 4 | |||||||||||||||||||
| Domain | 615 – 683 | 69 | HP | |||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||
| Modified residue | 277 | 1 | Phosphoserine By similarity | |||||||||||||||||||
| Modified residue | 280 | 1 | Phosphoserine By similarity | |||||||||||||||||||
| Modified residue | 282 | 1 | Phosphoserine By similarity | |||||||||||||||||||
| Modified residue | 372 | 1 | Phosphoserine | |||||||||||||||||||
| Modified residue | 373 | 1 | Phosphoserine | |||||||||||||||||||
| Modified residue | 388 | 1 | Phosphoserine | |||||||||||||||||||
| Modified residue | 394 | 1 | Phosphoserine | |||||||||||||||||||
| Modified residue | 503 | 1 | Phosphoserine | |||||||||||||||||||
| Modified residue | 504 | 1 | Phosphoserine | |||||||||||||||||||
Natural variations | ||||||||||||||||||||||
| Alternative sequence | 1 – 514 | 514 | Missing in isoform 4. | VSP_012126 | ||||||||||||||||||
| Alternative sequence | 297 – 358 | 62 | Missing in isoform 2 and isoform 3. | VSP_012127 | ||||||||||||||||||
| Alternative sequence | 402 – 450 | 49 | Missing in isoform 2. | VSP_012128 | ||||||||||||||||||
| Alternative sequence | 402 – 434 | 33 | Missing in isoform 3. | VSP_012129 | ||||||||||||||||||
| Alternative sequence | 647 – 683 | 37 | RHLSQ…QARLF → GNFWKSGCL in isoform 2. | VSP_012130 | ||||||||||||||||||
Experimental info | ||||||||||||||||||||||
| Sequence conflict | 227 | 1 | K → R in BAF82425. Ref.3 | |||||||||||||||||||
Secondary structure | ||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||
| Turn | 623 – 626 | 4 | ||||||||||||||||||||
| Turn | 630 – 633 | 4 | ||||||||||||||||||||
| Turn | 642 – 644 | 3 | ||||||||||||||||||||
| Helix | 645 – 648 | 4 | ||||||||||||||||||||
| Helix | 653 – 658 | 6 | ||||||||||||||||||||
| Helix | 662 – 665 | 4 | ||||||||||||||||||||
| Helix | 670 – 679 | 10 | ||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Two novel members of the ABLIM protein family, ABLIM-2 and -3, associate with STARS and directly bind F-actin." Barrientos T., Frank D., Kuwahara K., Bezprozvannaya S., Pipes G.C.T., Bassel-Duby R., Richardson J.A., Katus H.A., Olson E.N., Frey N. J. Biol. Chem. 282:8393-8403(2007) [PubMed: 17194709] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH F-ACTIN AND ABRA. Tissue: Heart. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed: 10048485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas." Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A. Oncogene 23:5901-5911(2004) [PubMed: 15221005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Hepatoblastoma. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon. |
| [6] | The German cDNA consortium Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 117-683 (ISOFORM 3). Tissue: Stomach. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-394; SER-503 AND SER-504, MASS SPECTROMETRY. Tissue: Epithelium. |
| [8] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-372; SER-373 AND SER-388, MASS SPECTROMETRY. Tissue: Platelet. |
| [9] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed: 18318008] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-503 AND SER-504, MASS SPECTROMETRY. Tissue: Liver. |
| [10] | "Solution structure of the villin headpiece domain of human actin-binding LIM protein homologue (KIAA0843 protein)." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 610-683. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| DQ413174 mRNA. Translation: ABD83327.1. AB020650 mRNA. Translation: BAA74866.2. Different initiation. AK289736 mRNA. Translation: BAF82425.1. AB075881 mRNA. Translation: BAD38663.1. BC001665 mRNA. Translation: AAH01665.1. AL833021 mRNA. Translation: CAH56270.1. | |||||||||||||||||||
| RefSeq | NP_055760.1. | ||||||||||||||||||
| UniGene | Hs.49688 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| SMR | O94929. Positions 136-207, 210-268. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | O94929. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSG00000173210. Homo sapiens. [Contig view] | ||||||||||||||||||
| GeneID | 22885. | ||||||||||||||||||
| KEGG | hsa:22885. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| H-InvDB | HIX0005296. | ||||||||||||||||||
| HGNC | HGNC:29132. ABLIM3. | ||||||||||||||||||
| HPA | HPA003245. | ||||||||||||||||||
| MIM | 611305. gene. | ||||||||||||||||||
| PharmGKB | PA134962761. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
| GeneCards | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOGENOM | O94929. | ||||||||||||||||||
| HOVERGEN | O94929. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | O94929. | ||||||||||||||||||
| CleanEx | HS_ABLIM3. | ||||||||||||||||||
| GermOnline | ENSG00000173210. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR003128. Villin_headpiece. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:1.10.950.10. VHP. 1 hit. G3DSA:2.10.110.10. Znf_LIM. 2 hits. | ||||||||||||||||||
| Pfam | PF00412. LIM. 4 hits. PF02209. VHP. 1 hit. [Graphical view] | ||||||||||||||||||
| ProDom | PD000094. LIM. 4 hits. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||
| SMART | SM00132. LIM. 4 hits. SM00153. VHP. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS51089. HP. 1 hit. PS00478. LIM_DOMAIN_1. 4 hits. PS50023. LIM_DOMAIN_2. 4 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 43475. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||

Clusters with