Reviewed,
UniProtKB/Swiss-Prot O94989 (ARHGF_HUMAN)
Last modified
November 25, 2008.
Version 57.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Rho guanine nucleotide exchange factor 15 Alternative name(s): Vsm-RhoGEF | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 841 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Specific GEF for RhoA activation and the regulation of vascular smooth muscle contractility. |
| Subunit structure | Interacts with EPHA4. |
| Tissue specificity | Expressed in the vascular smooth muscle of coronary artery. |
| Post-translational modification | Phosphorylated on tyrosine residues upon EFNA1 stimulation. |
| Sequence similarities | Contains 1 DH (DBL-homology) domain. |
Ontologies
Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Molecular function | GTPase activation Guanine-nucleotide releasing factor |
| PTM | Phosphoprotein |
Gene Ontology (GO) | |
| Biological process | regulation of Rho protein signal transduction Inferred from electronic annotation. Source: InterPro |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | GTPase activator activity Inferred from electronic annotation. Source: UniProtKB-KW Rho guanyl-nucleotide exchange factor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: O94989-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: O94989-2) The sequence of this isoform differs from the canonical sequence as follows: 201-234: DAGLACPPCCPCVCHTTRPGLELRWVPVGGYEEV → GECGGWGALGDLNPPIFSVFSANNFQGLPFQKWS 235-841: Missing. | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 841 | 841 | Rho guanine nucleotide exchange factor 15 | PRO_0000080932 | |||||
Regions | |||||||||
| Domain | 417 – 601 | 185 | DH | ||||||
| Compositional bias | 7 – 133 | 127 | Pro-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 201 – 234 | 34 | DAGLA…GYEEV → GECGGWGALGDLNPPIFSVF SANNFQGLPFQKWS in isoform 2. | VSP_011160 | |||||
| Alternative sequence | 235 – 841 | 607 | Missing in isoform 2. | VSP_011161 | |||||
Experimental info | |||||||||
| Sequence conflict | 155 | 1 | G → V in AAH36749. Ref.4 | ||||||
| Sequence conflict | 277 | 1 | L → P in AAH36749. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed: 10048485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed: 12168954] [Abstract] Cited for: SEQUENCE REVISION. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Thyroid. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [5] | "EphA4-mediated Rho activation via Vsm-RhoGEF expressed specifically in vascular smooth muscle cells." Ogita H., Kunimoto S., Kamioka Y., Sawa H., Masuda M., Mochizuki N. Circ. Res. 93:23-31(2003) [PubMed: 12775584] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, PHOSPHORYLATION, INTERACTION WITH EPHA4, REGULATION. |
Cross-references
Sequence databases | |
|---|---|
| AB020722 mRNA. Translation: BAA74938.2. Different initiation. AK023853 mRNA. Translation: BAB14703.1. BC036749 mRNA. Translation: AAH36749.1. | |
| RefSeq | NP_776089.2. |
| UniGene | Hs.443109 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | O94989. |
Genome annotation databases | |
| Ensembl | ENSG00000198844. Homo sapiens. [Contig view] |
| GeneID | 22899. |
| KEGG | hsa:22899. |
Organism-specific databases | |
| H-InvDB | HIX0013523. |
| HGNC | HGNC:15590. ARHGEF15. |
| MIM | 608504. gene. |
| PharmGKB | PA24970. |
| HUGE | Search... |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | O94989. |
| HOVERGEN | O94989. |
Gene expression databases | |
| ArrayExpress | O94989. |
| CleanEx | HS_ARHGEF15. |
| GermOnline | ENSG00000198844. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000219. DH-domain. IPR001331. GDS_CDC24_CS. [Graphical view] |
| Gene3D | G3DSA:1.20.900.10. RhoGEF. 1 hit. |
| Pfam | PF00621. RhoGEF. 1 hit. [Graphical view] |
| SMART | SM00325. RhoGEF. 1 hit. [Graphical view] |
| PROSITE | PS00741. DH_1. False negative. PS50010. DH_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 43527. |
| SOURCE | Search... |
Entry information
| Entry name | ARHGF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O94989 Secondary accession number(s): Q8N449, Q9H8B4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


