Skip Header

 
Contribute Send feedback

Reviewed, UniProtKB/Swiss-Prot P00519 (ABL1_HUMAN)

Last modified October 14, 2008. Version 134. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (8) | Third-party data | Customize display text xml rdf/xml gff fasta
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Binary interactions · Alternative products · Sequence annotation (Features) · Sequences · References · Web resources · Cross-references · Entry information · Relevant documents

Names and origin

Protein namesRecommended name:
    Proto-oncogene tyrosine-protein kinase ABL1
    EC=2.7.10.2
Alternative name(s):
    Abelson murine leukemia viral oncogene homolog 1
    c-ABL
    p150
Gene names
Name: ABL1
Synonyms: ABL, JTK7
OrganismHomo sapiens (Human)
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1130 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is not processed.
Protein existenceEvidence at protein level.

General annotation (Comments)

Function

Regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion. Localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics. Regulates DNA repair potentially by activating the proapoptotic pathway when the DNA damage is too severe to be repaired.

Catalytic activity

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Cofactor

Magnesium or manganese.

Enzyme regulation

Stabilized in the inactive form by an association between the SH3 domain and the SH2-TK linker region, interactions of the amino-terminal cap, and contributions from an amino-terminal myristoyl group and phospholipids. Activated by autophosphorylation as well as by SRC-family kinase-mediated phosphorylation. Activated by RIN1 binding to the SH2 and SH3 domains. Inhibited by imatinib mesylate (Gleevec) which is used for the treatment of chronic myeloid leukemia (CML).

Subunit structure

Interacts with SORBS1 following insulin stimulation. Found in a trimolecular complex containing CDK5 and CABLES1. Interacts with CABLES1 and PSTPIP1. Interacts with ZDHHC16 By similarity. Interacts with INPPL1/SHIP2.

Subcellular location

Cytoplasmcytoskeleton. Nucleus. Note= The myristoylated c-ABL protein is reported to be nuclear.

Tissue specificity

Widely expressed.

Post-translational modification

Phosphorylated by PRKDC By similarity. DNA damage-induced activation of c-Abl requires the function of ATM and Ser-446 phosphorylation. Isoform IB is myristoylated on Gly-2.

Involvement in disease

A chromosomal aberration involving ABL1 is a cause of chronic myeloid leukemia (CML) [MIM:608232]. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL).

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. ABL subfamily.

Contains 1 protein kinase domain.

Contains 1 SH2 domain.

Contains 1 SH3 domain.

Ontologies

Keywords

   Biological processCell adhesion
   Cellular componentCytoplasm
Cytoskeleton
Nucleus
   Coding sequence diversityAlternative splicing
Chromosomal rearrangement
Polymorphism
   DiseaseProto-oncogene
   DomainSH2 domain
SH3 domain
   LigandATP-binding
Magnesium
Manganese
Metal-binding
Nucleotide-binding
   Molecular functionKinase
Transferase
Tyrosine-protein kinase
   PTMLipoprotein
Myristate
Phosphoprotein
   Technical term3D-structure

Gene Ontology (GO)

   Biological processDNA damage response, signal transduction resulting in induction of apoptosis

Traceable author statement. Source: ProtInc

actin cytoskeleton organization

Inferred from sequence or structural similarity. Source: UniProtKB

mismatch repair

Traceable author statement. Source: ProtInc

peptidyl-tyrosine phosphorylation Ref.12

Inferred from direct assay. Source: UniProtKB

positive regulation of oxidoreductase activity

Inferred from direct assay. Source: UniProtKB

regulation of transcription during S-phase of mitotic cell cycle

Traceable author statement. Source: ProtInc

   Cellular componentnucleus

Non-traceable author statement. Source: UniProtKB

   Molecular functionATP binding Ref.12

Inferred from direct assay. Source: UniProtKB

DNA binding

Non-traceable author statement. Source: UniProtKB

magnesium ion binding Ref.12

Inferred from direct assay. Source: UniProtKB

manganese ion binding Ref.12

Inferred from direct assay. Source: UniProtKB

protein C-terminus binding

Inferred from physical interaction. Source: UniProtKB

protein tyrosine kinase activity Ref.12

Inferred from direct assay. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform IA (identifier: P00519-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform IB (identifier: P00519-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MLEICLKLVGCKSKKGLSSSSSCYLE → MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEH
Notes: Myristoylated on Gly-2.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical view

Molecule processing

Chain1 – 11301130Proto-oncogene tyrosine-protein kinase ABL1

Regions

Domain61 – 12161SH3
Domain127 – 21791SH2
Domain242 – 493252Protein kinase
Nucleotide binding248 – 2569ATP By similarity
Region1 – 6060CAP
Motif605 – 6095Nuclear localization signal Potential
Compositional bias18 – 225Poly-Ser
Compositional bias605 – 6095Poly-Lys
Compositional bias782 – 1019238Pro-rich
Compositional bias897 – 9037Poly-Pro

Sites

Active site3631Proton acceptor By similarity
Binding site2711ATP By similarity
Site26 – 272Breakpoint for translocation to form BCR-ABL oncogene

Amino acid modifications

Modified residue1851Phosphotyrosine
Modified residue2261Phosphotyrosine; by autocatalysis
Modified residue2531Phosphotyrosine
Modified residue2571Phosphotyrosine
Modified residue2641Phosphotyrosine
Modified residue3931Phosphotyrosine; by autocatalysis and SRC-type Tyr-kinases
Modified residue3941Phosphothreonine
Modified residue4461Phosphoserine By similarity
Modified residue4691Phosphotyrosine
Modified residue5691Phosphoserine
Modified residue6831Phosphoserine
Modified residue8051Phosphoserine
Modified residue8091Phosphoserine
Modified residue9491Phosphoserine

Natural variations

Alternative sequence1 – 2626MLEIC…SCYLE → MGQQPGKVLGDQRRPSLPAL HFIKGAGKKESSRHGGPHCN VFVEH in isoform IB.
Natural variant471R → G in a lung large cell carcinoma sample; somatic mutation.
Natural variant1661R → K in a melanoma sample; somatic mutation.
Natural variant7061G → V
Natural variant8101P → L
Natural variant8521T → P
Natural variant9001P → S
Natural variant9721S → L

Experimental info

Sequence conflict1401L → P in AAA51561. Ref.2
Sequence conflict1591G → S in AAA51561. Ref.2
Sequence conflict424 – 4252AF → GK Ref.6
Sequence conflict4451L → R in AAA51561. Ref.2
Sequence conflict4591E → K in AAA51561. Ref.2
Sequence conflict5201S → T in AAA51561. Ref.2
Sequence conflict7191A → V in AAA51561. Ref.2
Sequence conflict8371G → E in CAA34438. Ref.1
Sequence conflict8371G → W in AAA51561. Ref.2
Sequence conflict8631G → R in AAA51561. Ref.2
Sequence conflict8941R → K in AAA51561. Ref.2
Sequence conflict917 – 9193SPS → RPG in AAA51561. Ref.2
Sequence conflict9521G → A in AAA51561. Ref.2
Sequence conflict967 – 9682QS → HP in AAA51561. Ref.2
Sequence conflict9821P → PL in AAA51561. Ref.2
Sequence conflict10221Missing in AAA51561. Ref.2
Sequence conflict10451R → G in AAA51561. Ref.2
Sequence conflict11031T → S in AAA51561. Ref.2

Secondary structure

.................................................................................................... 1130
Helix Strand Turn

Details...