Reviewed,
UniProtKB/Swiss-Prot P01011 (AACT_HUMAN)
Last modified
November 25, 2008.
Version 124.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Alpha-1-antichymotrypsin Short name=ACT Alternative name(s): Cell growth-inhibiting gene 24/25 protein Cleaved into the following chain: 1- Recommended name: Alpha-1-antichymotrypsin His-Pro-less | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 423 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Although its physiological function is unclear, it can inhibit neutrophil cathepsin G and mast cell chymase, both of which can convert angiotensin-1 to the active angiotensin-2. |
| Subunit structure | Interacts with DNAJC1. |
| Subcellular location | |
| Tissue specificity | Plasma. Synthesized in the liver. Like the related alpha-1-antitrypsin, its concentration increases in the acute phase of inflammation or infection. Found in the myloid plaques from the hippocampus of Alzheimer's disease brains. |
| Domain | The reactive center loop (RCL) extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site within the RCL, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable. |
| Involvement in disease | Defects in SERPINA3 may be a cause of chronic obstructive pulmonary disease (COPD) [MIM:107280]. |
| Miscellaneous | Alpha-1-antichymotrypsin can bind DNA. |
| Sequence similarities | Belongs to the serpin family. |
| Caution | It is uncertain whether Met-1 or Met-4 is the initiator. |
| Sequence caution | The sequence AAA51543.1 differs from that shown. Reason: Frameshift at positions 101, 106, 111, 117, 123, 129 and 421. The sequence AAT08029.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AAT08029.1 differs from that shown. Reason: Frameshift at position 4. |
Ontologies
Keywords | |
|---|---|
| Biological process | Acute phase |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Signal |
| Molecular function | Protease inhibitor Serine protease inhibitor |
| PTM | Glycoprotein |
| Technical term | 3D-structure Direct protein sequencing |
Gene Ontology (GO) | |
| Biological process | acute-phase response Inferred from electronic annotation. Source: UniProtKB-KW regulation of lipid metabolic processNon-traceable author statement. Source: UniProtKB |
| Cellular component | extracellular region Ref.7 Non-traceable author statement. Source: UniProtKB nucleus Ref.17Traceable author statement. Source: UniProtKB |
| Molecular function | DNA binding Ref.7 Ref.17 Traceable author statement. Source: UniProtKB chymotrypsin inhibitor activity Ref.7Non-traceable author statement. Source: UniProtKB protein binding Ref.17Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P01011-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P01011-2) The sequence of this isoform differs from the canonical sequence as follows: 215-216: AK → ER 217-423: Missing. | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P01011-3) The sequence of this isoform differs from the canonical sequence as follows: 64-95: LVLKAPDKNVIFSPLSISTALAFLSLGAHNTT → SPRWSIRLCLMYLRRAQKHLLPQQSKSPSFLH 96-423: Missing. | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 24 – 423 | 400 | Alpha-1-antichymotrypsin | PRO_0000032411 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 26 – 423 | 398 | Alpha-1-antichymotrypsin His-Pro-less | PRO_0000032412 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 235 – 237 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 369 – 394 | 26 | RCL | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 383 – 384 | 2 | Reactive bond | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 93 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 106 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 127 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 186 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 271 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 64 – 95 | 32 | LVLKA…AHNTT → SPRWSIRLCLMYLRRAQKHL LPQQSKSPSFLH in isoform 3. | VSP_014225 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 96 – 423 | 328 | Missing in isoform 3. | VSP_014226 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 215 – 216 | 2 | AK → ER in isoform 2. | VSP_014227 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 217 – 423 | 207 | Missing in isoform 2. | VSP_014228 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 9 | 1 | A → T: dbSNP rs4934. | VAR_006973 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 78 | 1 | L → P in COPD; Bochum-1. dbSNP rs1800463. | VAR_006974 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 167 | 1 | A → G | VAR_006975 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | P → A in COPD; Bonn-1. dbSNP rs17473. | VAR_006976 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 267 | 1 | K → R: dbSNP rs17853314. | VAR_037902 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 401 | 1 | M → V Associated with occlusive-cerebrovascular disease; Isehara-1. | VAR_006977 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 407 | 1 | D → G: dbSNP rs10956. | VAR_011742 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 55 | 1 | D → S AA sequence Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 69 | 1 | P → L in AAA51543. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 101 | 1 | K → R in BAD92297. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 106 | 1 | N → Y in AAT08028. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 198 | 1 | D → N in AAT08029. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 199 | 1 | L → P in AAA51543. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 234 | 1 | S → N in AAT08029. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 339 | 1 | S → G in AAT08028. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 346 | 1 | I → S in AAT08028. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 361 – 363 | 3 | AVL → VVS in AAA51543. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 49 – 67 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 73 – 75 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 77 – 88 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 93 – 102 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 107 – 109 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 112 – 126 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 144 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 151 – 161 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 164 – 168 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 173 – 187 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 188 – 190 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 203 – 219 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 223 – 225 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 227 – 234 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 237 – 256 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 257 – 260 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 261 – 279 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 289 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 302 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 304 – 314 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 316 – 323 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 325 – 330 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 335 – 337 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 344 – 347 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 348 – 350 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 352 – 365 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 367 – 382 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 391 – 394 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 399 – 405 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 412 – 418 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence homology between human alpha 1-antichymotrypsin, alpha 1-antitrypsin, and antithrombin III." Chandra T., Stackhouse R., Kidd V.J., Robson K.J.H., Woo S.L.C. Biochemistry 22:5055-5061(1983) [PubMed: 6606438] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [2] | "A leucine-to-proline substitution causes a defective alpha 1-antichymotrypsin allele associated with familial obstructive lung disease." Poller W., Faber J.-P., Weidinger S., Tief K., Scholz S., Fischer M., Olek K., Kirchgesser M., Heidtmann H.-H. Genomics 17:740-743(1993) [PubMed: 8244391] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INVOLVEMENT IN COPD, VARIANTS BOCHUM-1 PRO-78 AND BONN-1 ALA-252. |
| [3] | "Identification of a human cell growth inhibiting gene." Kim J.W. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-9. |
| [4] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno F.R. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-9. Tissue: Brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS THR-9 AND ARG-267. Tissue: Brain, Liver and Skin. |
| [6] | "Immunochemical identification of the serine protease inhibitor alpha 1-antichymotrypsin in the brain amyloid deposits of Alzheimer's disease." Abraham C.R., Selkoe D.J., Potter H. Cell 52:487-501(1988) [PubMed: 3257719] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-46, TISSUE SPECIFICITY. Tissue: Liver. |
| [7] | "Molecular studies define the primary structure of alpha1-antichymotrypsin (ACT) protease inhibitor in Alzheimer's disease brains. Comparison of act in hippocampus and liver." Hwang S.-R., Steineckert B., Kohn A., Palkovits M., Hook V.Y.H. J. Biol. Chem. 274:1821-1827(1999) [PubMed: 9880565] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-423 (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Hippocampus. |
| [8] | Rubin H. Submitted (OCT-1989) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 22-86 AND 130-423 (ISOFORM 1). |
| [9] | "The microheterogeneity of desialylated alpha 1-antichymotrypsin: the occurrence of two amino-terminal isoforms, one lacking a His-Pro dipeptide." Lindmark B., Hilja H., Alan R., Eriksson S. Biochim. Biophys. Acta 997:90-95(1989) [ |

Clusters with