Skip Header

 
Contribute Send feedback

Reviewed, UniProtKB/Swiss-Prot P04150 (GCR_HUMAN)

Last modified July 22, 2008. Version 138. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data | Customize display text xml rdf/xml gff fasta
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Binary interactions · Alternative products · Sequence annotation (Features) · Sequences · References · Web resources · Cross-references · Entry information · Relevant documents

Names and origin

Protein namesRecommended name:
    Glucocorticoid receptor
      Short name(s)=GR
Alternative name(s):
    Nuclear receptor subfamily 3 group C member 1
Gene names
Name: NR3C1
Synonyms: GRL
OrganismHomo sapiens (Human)
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length777 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is not processed.
Protein existenceEvidence at protein level.

General annotation (Comments)

Function

Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Involved in chromatin remodeling. Plays a significant role in transactivation. Involved in nuclear translocation By similarity.

Subunit structure

Heteromultimeric cytoplasmic complex with HSP90, HSP70, and FKBP5 or another immunophilin, or the immunophilin homolog PPP5C. Directly interacts with UNC45A. Upon ligand binding FKBP5 dissociates from the complex and FKBP4 takes its place, thereby linking the complex to dynein and mediating transport to the nucleus, where the complex dissociates By similarity. Binds to DNA as a homodimer, and as a heterodimer with NR3C2 or the retinoid X receptor. Binds STAT5A and STAT5B homodimers and heterodimers. Interacts with NRIP1, POU2F1, POU2F2 and TRIM28. Interacts with NCOA1, NCOA3, SMARCA4, SMARCC1, SMARCD1, and SMARCE1 By similarity. Interacts with several coactivator complexes, including the SMARCA4 complex, CREBBP/EP300, TADA2L and p160 coactivators such as NCOA2 and NCOA6. Interaction with BAG1 inhibits transactivation. Interacts with HEXIM1, PELP1 and TGFB1I1.

Subcellular location

Cytoplasm. Nucleus. Note= Cytoplasmic in the absence of ligand, nuclear after ligand-binding.

Tissue specificity

Widely expressed. In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and atrioventricular node as well as whole adult and fetal heart.

Domain

Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal steroid-binding domain.

Post-translational modification

Increased proteasome-mediated degradation in response to glucocorticoids.

Phosphorylated in the absence of hormone; becomes hyperphosphorylated in the presence of glucocorticoid. The Ser-203-phosphorylated form is mainly cytoplasmic, and the Ser-211-phosphorylated form is nuclear. Transcriptional activity correlates with the amount of phosphorylation at Ser-211.

Sumoylated; this reduces transcription transactivation.

Ubiquitinated; restricts glucocorticoid-mediated transcriptional signaling By similarity.

Polymorphism

Carriers of the 22-Glu-Lys-23 allele are relatively more resistant to the effects of GCs with respect to the sensitivity of the adrenal feedback mechanism than non-carriers, resulting in a better metabolic health profile. Carriers have a better survival than non-carriers, as well as lower serum CRP levels. The 22-Glu-Lys-23 polymorphism is associated with a sex-specific, beneficial body composition at young-adult age, as well as greater muscle strength in males.

Involvement in disease

Defects in NR3C1 are a cause of glucocorticoid resistance [MIM:138040]; also known as cortisol resistance. It is a hypertensive, hyperandrogenic disorder characterized by increased serum cortisol concentrations. Inheritance is autosomal dominant.

Miscellaneous

High constitutive expression of isoform beta by neutrophils may provide a mechanism by which these cells escape glucocorticoid-induced cell death. Up-regulation by proinflammatory cytokines such as IL8 further enhances their survival in the presence of glucocorticoids during inflammation.

Can up- or down-modulate aggregation and nuclear localization of expanded polyglutamine polypeptides derived from AR and HD through specific regulation of gene expression. Aggregation and nuclear localization of expanded polyglutamine proteins are regulated cellular processes that can be modulated by this receptor, a well-characterized transcriptional regulator.

Sequence similarities

Belongs to the nuclear hormone receptor family. NR3 subfamily.

Contains 1 nuclear receptor DNA-binding domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

MvpQ626671EBI-493507,EBI-918333From a different organism.
SMARCA4P515321EBI-493507,EBI-302489
SMARCC1Q929221EBI-493507,EBI-355653

Alternative products

This entry describes 9 isoforms produced by alternative splicing and alternative initiation. [Align] [Select]

Notes: At least 4 isoforms, Alpha (shown here), Alpha-B, Beta and Beta-B, are produced by alternative initiation at Met-1 and Met-27. The existence of isoform Alpha and isoform Alpha-B has been proved by mutagenesis. As the sequence environment of the 2 potential ATG initiator codons is the same for the other altrnatively spliced isoforms, alternative initiation of translation could also occur on these transcripts. Additional isoforms seem to exist.
Isoform Alpha (identifier: P04150-1)

Also known as: Alpha-A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Notes: Predominant physiological form. Isoform Alpha-B is produced by alternative initiation at Met-27 of isoform Alpha. Both isoforms exhibit similar subcellular location and nuclear translocation after ligand activation. Isoform Alpha-B appears to be more susceptible to degradation, at least when expressed in mammalian cells, but more effective in transcriptional activation and not in transrepression.
Isoform Beta (identifier: P04150-2)

Also known as: Beta-A;

The sequence of this isoform differs from the canonical sequence as follows:
     728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI
Notes: No hormone-binding activity. Widely expressed at low level. Localized largely in the nucleus.
Isoform Alpha-2 (identifier: P04150-3)

Also known as: Gamma;

The sequence of this isoform differs from the canonical sequence as follows:
     451-451: G → GR
Notes: Due to a partial intron retention. Lower transcriptional activity. Expressed at low level.
Isoform Beta-2 (identifier: P04150-6)

The sequence of this isoform differs from the canonical sequence as follows:
     451-451: G → GR
     728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI
Notes: Due to a partial intron retention.
Isoform GR-A alpha (identifier: P04150-5)

The sequence of this isoform differs from the canonical sequence as follows:
     491-674: Missing.
Notes: Lacks exons 5, 6 and 7. Found in glucocorticoid-resistant myeloma patients.
Isoform GR-A beta (identifier: P04150-7)

The sequence of this isoform differs from the canonical sequence as follows:
     491-674: Missing.
     728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI
Notes: Lacks exons 5, 6 and 7.
Isoform GR-P (identifier: P04150-4)

The sequence of this isoform is not available.
Notes: Encoded by exons 2-7 plus several basepairs from the subsequent intron region. Lacks the ligand binding domain. Accounts for up to 10-20% of mRNAs.
Isoform Alpha-B (identifier: P04150-8)

Also known as: Beta-B;

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
Notes: Produced by alternative initiation at Met-27 of isoform Alpha. Both isoforms exhibit similar subcellular location and nuclear translocation after ligand activation. Isoform Alpha-B appears to be more susceptible to degradation, at least when expressed in mammalian cells, but more effective in transcriptional activation and not in transrepression.
Isoform Beta-B (identifier: P04150-9)

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI
Notes: Produced by alternative initiation at Met-27 of isoform Beta.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical view

Molecule processing

Chain1 – 777777Glucocorticoid receptor

Regions

DNA binding421 – 48666Nuclear receptor
Zinc finger421 – 44121NR C4-type
Zinc finger457 – 48125NR C4-type
Region1 – 420420Modulating
Region487 – 52741Hinge
Region528 – 777250Steroid-binding
Compositional bias399 – 41820Glu/Pro/Ser/Thr-rich (PEST region)

Amino acid modifications

Modified residue1131Phosphoserine By similarity
Modified residue1411Phosphoserine By similarity
Modified residue2031Phosphoserine
Modified residue2111Phosphoserine
Modified residue2261Phosphoserine By similarity
Cross-link277Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
Cross-link293Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
Cross-link419Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Probable

Natural variations

Alternative sequence1 – 2626Missing in isoform Alpha-B and isoform Beta-B.
Alternative sequence4511G → GR in isoform Alpha-2 and isoform Beta-2.
Alternative sequence491 – 674184Missing in isoform GR-A alpha and isoform GR-A beta.
Alternative sequence728 – 77750VVENL…LFHQK → NVMWLKPESTSHTLI in isoform Beta, isoform Beta-B, isoform Beta-2 and isoform GR-A beta.
Natural variant231R → K: dbSNP rs6190.
Natural variant291F → L
Natural variant651F → V: dbSNP rs6192.
Natural variant1121L → F
Natural variant2331D → N
Natural variant3631N → S May increase sensitivity to exogenously administered glucocorticoids; may contribute to central obesity in men and show lack of association with other risk factors for coronary heart disease and diabetes mellitus. dbSNP rs6195.
Natural variant4211C → Y in a glucocorticoid resistant leukemia cell line.
Natural variant4771R → H in glucocorticoid resistance.
Natural variant5591I → N in glucocorticoid resistance; interferes with translocation to the nucleus and thereby strongly reduces transcription activation. Is equally impaired in nuclear export. Acts as dominant negative mutant.
Natural variant5711V → A in pseudohermaphroditism; female with hypokalemia due to glucocorticoid resistance; 6-fold reduction in binding affinity compared with the wild-type receptor.
Natural variant6411D → V in glucocorticoid resistance.
Natural variant6791G → S in glucocorticoid resistance; has 50% binding affinity.
Natural variant7291V → I in glucocorticoid resistance.
Natural variant7471I → M in glucocorticoid resistance; alters interaction with NCOA2 and strongly reduces transcription activation; acts as dominant negative mutant.
Natural variant7531L → F in two glucocorticoid resistant leukemia cell lines lacking the normal allele.

Experimental info

Mutagenesis11M → T: Abolishes expression of A-type isoforms
Mutagenesis271M → T: Abolishes expression of B-type isoforms
Mutagenesis1911F → D: Reduces transactivation by the ADA complex
Mutagenesis1931I → D: Reduces transactivation by the ADA complex
Mutagenesis1941L → A: Strongly reduces transactivation by the ADA complex; when associated with V-224 and F-225
Mutagenesis1971L → E: Reduces transactivation by the ADA complex
Mutagenesis2131W → A: Strongly reduces transactivation by the ADA complex
Mutagenesis2241L → V: Strongly reduces transactivation by the ADA complex; when associated with A-194 and F-225
Mutagenesis2251L → F: Strongly reduces transactivation by the ADA complex; when associated with A-194 and V-224
Mutagenesis2351F → L: Strongly reduces transactivation by the ADA complex; when associated with V-236
Mutagenesis2361L → V: Strongly reduces transactivation by the ADA complex; when associated with L-235
Mutagenesis2771K → R: Strongly reduces sumoylation. Almost complete loss of sumoylation; when associated with R-293
Mutagenesis2931K → R: Strongly reduces sumoylation. Almost complete loss of sumoylation; when associated with R-277
Mutagenesis5851R → A: Reduces activation mediated by ligand binding domain; when associated with A-590
Mutagenesis5901D → A: Reduces activation mediated by ligand binding domain; when associated with A-585
Mutagenesis6021F → S: Increases solubility. No effect on transactivation by dexamethasone
Mutagenesis6251P → A: Decreases transactivation by dexamethasone by 95%
Mutagenesis6281I → A: Decreases dimerization and transactivation by dexamethasone; when associated with S-602
Mutagenesis7031K → R: Slightly reduces sumoylation
Sequence conflict3991R → G in BAD97314. Ref.5
Sequence conflict7541A → T in BAD97314. Ref.5

Secondary structure

................................ 777
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform Alpha (Alpha-A) [UniParc].

Last modified November 1, 1986. Version 1.
Checksum: C5C90C9A5DD16AAB

FASTA77785,659
        10         20         30         40         50         60 
MDSKESLTPG REENPSSVLA QERGDVMDFY KTLRGGATVK VSASSPSLAV ASQSDSKQRR 

        70         80         90        100        110        120 
LLVDFPKGSV SNAQQPDLSK AVSLSMGLYM GETETKVMGN DLGFPQQGQI SLSSGETDLK 

       130        140        150        160        170        180 
LLEESIANLN RSTSVPENPK SSASTAVSAA PTEKEFPKTH SDVSSEQQHL KGQTGTNGGN 

       190        200        210        220        230        240 
VKLYTTDQST FDILQDLEFS SGSPGKETNE SPWRSDLLID ENCLLSPLAG EDDSFLLEGN 

       250        260        270        280        290        300 
SNEDCKPLIL PDTKPKIKDN GDLVLSSPSN VTLPQVKTEK EDFIELCTPG VIKQEKLGTV 

       310        320        330        340        350        360 
YCQASFPGAN IIGNKMSAIS VHGVSTSGGQ MYHYDMNTAS LSQQQDQKPI FNVIPPIPVG 

       370        380        390        400        410        420 
SENWNRCQGS GDDNLTSLGT LNFPGRTVFS NGYSSPSMRP DVSSPPSSSS TATTGPPPKL 

       430        440        450        460        470        480 
CLVCSDEASG CHYGVLTCGS CKVFFKRAVE GQHNYLCAGR NDCIIDKIRR KNCPACRYRK 

       490        500        510        520        530        540 
CLQAGMNLEA RKTKKKIKGI QQATTGVSQE TSENPGNKTI VPATLPQLTP TLVSLLEVIE 

       550        560        570        580        590        600 
P