Reviewed,
UniProtKB/Swiss-Prot P04150 (GCR_HUMAN)
Last modified
July 22, 2008.
Version 138.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Glucocorticoid receptor Short name(s)=GR Alternative name(s): Nuclear receptor subfamily 3 group C member 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 777 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Involved in chromatin remodeling. Plays a significant role in transactivation. Involved in nuclear translocation By similarity. |
| Subunit structure | Heteromultimeric cytoplasmic complex with HSP90, HSP70, and FKBP5 or another immunophilin, or the immunophilin homolog PPP5C. Directly interacts with UNC45A. Upon ligand binding FKBP5 dissociates from the complex and FKBP4 takes its place, thereby linking the complex to dynein and mediating transport to the nucleus, where the complex dissociates By similarity. Binds to DNA as a homodimer, and as a heterodimer with NR3C2 or the retinoid X receptor. Binds STAT5A and STAT5B homodimers and heterodimers. Interacts with NRIP1, POU2F1, POU2F2 and TRIM28. Interacts with NCOA1, NCOA3, SMARCA4, SMARCC1, SMARCD1, and SMARCE1 By similarity. Interacts with several coactivator complexes, including the SMARCA4 complex, CREBBP/EP300, TADA2L and p160 coactivators such as NCOA2 and NCOA6. Interaction with BAG1 inhibits transactivation. Interacts with HEXIM1, PELP1 and TGFB1I1. |
| Subcellular location | Cytoplasm. Nucleus. Note= Cytoplasmic in the absence of ligand, nuclear after ligand-binding. |
| Tissue specificity | Widely expressed. In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and atrioventricular node as well as whole adult and fetal heart. |
| Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal steroid-binding domain. |
| Post-translational modification | Increased proteasome-mediated degradation in response to glucocorticoids. Phosphorylated in the absence of hormone; becomes hyperphosphorylated in the presence of glucocorticoid. The Ser-203-phosphorylated form is mainly cytoplasmic, and the Ser-211-phosphorylated form is nuclear. Transcriptional activity correlates with the amount of phosphorylation at Ser-211. Sumoylated; this reduces transcription transactivation. Ubiquitinated; restricts glucocorticoid-mediated transcriptional signaling By similarity. |
| Polymorphism | Carriers of the 22-Glu-Lys-23 allele are relatively more resistant to the effects of GCs with respect to the sensitivity of the adrenal feedback mechanism than non-carriers, resulting in a better metabolic health profile. Carriers have a better survival than non-carriers, as well as lower serum CRP levels. The 22-Glu-Lys-23 polymorphism is associated with a sex-specific, beneficial body composition at young-adult age, as well as greater muscle strength in males. |
| Involvement in disease | Defects in NR3C1 are a cause of glucocorticoid resistance [MIM:138040]; also known as cortisol resistance. It is a hypertensive, hyperandrogenic disorder characterized by increased serum cortisol concentrations. Inheritance is autosomal dominant. |
| Miscellaneous | High constitutive expression of isoform beta by neutrophils may provide a mechanism by which these cells escape glucocorticoid-induced cell death. Up-regulation by proinflammatory cytokines such as IL8 further enhances their survival in the presence of glucocorticoids during inflammation. Can up- or down-modulate aggregation and nuclear localization of expanded polyglutamine polypeptides derived from AR and HD through specific regulation of gene expression. Aggregation and nuclear localization of expanded polyglutamine proteins are regulated cellular processes that can be modulated by this receptor, a well-characterized transcriptional regulator. |
| Sequence similarities | Belongs to the nuclear hormone receptor family. NR3 subfamily. Contains 1 nuclear receptor DNA-binding domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Mvp | Q62667 | 1 | EBI-493507,EBI-918333 | From a different organism. |
| SMARCA4 | P51532 | 1 | EBI-493507,EBI-302489 | |
| SMARCC1 | Q92922 | 1 | EBI-493507,EBI-355653 |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] Notes: At least 4 isoforms, Alpha (shown here), Alpha-B, Beta and Beta-B, are produced by alternative initiation at Met-1 and Met-27. The existence of isoform Alpha and isoform Alpha-B has been proved by mutagenesis. As the sequence environment of the 2 potential ATG initiator codons is the same for the other altrnatively spliced isoforms, alternative initiation of translation could also occur on these transcripts. Additional isoforms seem to exist. | |||||
| Isoform Alpha (identifier: P04150-1) Also known as: Alpha-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Notes: Predominant physiological form. Isoform Alpha-B is produced by alternative initiation at Met-27 of isoform Alpha. Both isoforms exhibit similar subcellular location and nuclear translocation after ligand activation. Isoform Alpha-B appears to be more susceptible to degradation, at least when expressed in mammalian cells, but more effective in transcriptional activation and not in transrepression. | |||||
| Isoform Beta (identifier: P04150-2) Also known as: Beta-A; The sequence of this isoform differs from the canonical sequence as follows: 728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI | |||||
| Notes: No hormone-binding activity. Widely expressed at low level. Localized largely in the nucleus. | |||||
| Isoform Alpha-2 (identifier: P04150-3) Also known as: Gamma; The sequence of this isoform differs from the canonical sequence as follows: 451-451: G → GR | |||||
| Notes: Due to a partial intron retention. Lower transcriptional activity. Expressed at low level. | |||||
| Isoform Beta-2 (identifier: P04150-6) The sequence of this isoform differs from the canonical sequence as follows: 451-451: G → GR 728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI | |||||
| Notes: Due to a partial intron retention. | |||||
| Isoform GR-A alpha (identifier: P04150-5) The sequence of this isoform differs from the canonical sequence as follows: 491-674: Missing. | |||||
| Notes: Lacks exons 5, 6 and 7. Found in glucocorticoid-resistant myeloma patients. | |||||
| Isoform GR-A beta (identifier: P04150-7) The sequence of this isoform differs from the canonical sequence as follows: 491-674: Missing. 728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI | |||||
| Notes: Lacks exons 5, 6 and 7. | |||||
| Isoform GR-P (identifier: P04150-4) The sequence of this isoform is not available. | |||||
| Notes: Encoded by exons 2-7 plus several basepairs from the subsequent intron region. Lacks the ligand binding domain. Accounts for up to 10-20% of mRNAs. | |||||
| Isoform Alpha-B (identifier: P04150-8) Also known as: Beta-B; The sequence of this isoform differs from the canonical sequence as follows: 1-26: Missing. | |||||
| Notes: Produced by alternative initiation at Met-27 of isoform Alpha. Both isoforms exhibit similar subcellular location and nuclear translocation after ligand activation. Isoform Alpha-B appears to be more susceptible to degradation, at least when expressed in mammalian cells, but more effective in transcriptional activation and not in transrepression. | |||||
| Isoform Beta-B (identifier: P04150-9) The sequence of this isoform differs from the canonical sequence as follows: 1-26: Missing. 728-777: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK → NVMWLKPESTSHTLI | |||||
| Notes: Produced by alternative initiation at Met-27 of isoform Beta. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | |||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 777 | 777 | Glucocorticoid receptor | ||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||
| DNA binding | 421 – 486 | 66 | Nuclear receptor | ||||||||||||||||||||||||||||||||||||
| Zinc finger | 421 – 441 | 21 | NR C4-type | ||||||||||||||||||||||||||||||||||||
| Zinc finger | 457 – 481 | 25 | NR C4-type | ||||||||||||||||||||||||||||||||||||
| Region | 1 – 420 | 420 | Modulating | ||||||||||||||||||||||||||||||||||||
| Region | 487 – 527 | 41 | Hinge | ||||||||||||||||||||||||||||||||||||
| Region | 528 – 777 | 250 | Steroid-binding | ||||||||||||||||||||||||||||||||||||
| Compositional bias | 399 – 418 | 20 | Glu/Pro/Ser/Thr-rich (PEST region) | ||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 113 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 141 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 203 | 1 | Phosphoserine | ||||||||||||||||||||||||||||||||||||
| Modified residue | 211 | 1 | Phosphoserine | ||||||||||||||||||||||||||||||||||||
| Modified residue | 226 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Cross-link | 277 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | |||||||||||||||||||||||||||||||||||||
| Cross-link | 293 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | |||||||||||||||||||||||||||||||||||||
| Cross-link | 419 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Probable | |||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 26 | 26 | Missing in isoform Alpha-B and isoform Beta-B. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 451 | 1 | G → GR in isoform Alpha-2 and isoform Beta-2. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 491 – 674 | 184 | Missing in isoform GR-A alpha and isoform GR-A beta. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 728 – 777 | 50 | VVENL…LFHQK → NVMWLKPESTSHTLI in isoform Beta, isoform Beta-B, isoform Beta-2 and isoform GR-A beta. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 23 | 1 | R → K: dbSNP rs6190. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 29 | 1 | F → L | ||||||||||||||||||||||||||||||||||||
| Natural variant | 65 | 1 | F → V: dbSNP rs6192. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 112 | 1 | L → F | ||||||||||||||||||||||||||||||||||||
| Natural variant | 233 | 1 | D → N | ||||||||||||||||||||||||||||||||||||
| Natural variant | 363 | 1 | N → S May increase sensitivity to exogenously administered glucocorticoids; may contribute to central obesity in men and show lack of association with other risk factors for coronary heart disease and diabetes mellitus. dbSNP rs6195. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 421 | 1 | C → Y in a glucocorticoid resistant leukemia cell line. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 477 | 1 | R → H in glucocorticoid resistance. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 559 | 1 | I → N in glucocorticoid resistance; interferes with translocation to the nucleus and thereby strongly reduces transcription activation. Is equally impaired in nuclear export. Acts as dominant negative mutant. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 571 | 1 | V → A in pseudohermaphroditism; female with hypokalemia due to glucocorticoid resistance; 6-fold reduction in binding affinity compared with the wild-type receptor. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 641 | 1 | D → V in glucocorticoid resistance. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 679 | 1 | G → S in glucocorticoid resistance; has 50% binding affinity. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 729 | 1 | V → I in glucocorticoid resistance. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 747 | 1 | I → M in glucocorticoid resistance; alters interaction with NCOA2 and strongly reduces transcription activation; acts as dominant negative mutant. | ||||||||||||||||||||||||||||||||||||
| Natural variant | 753 | 1 | L → F in two glucocorticoid resistant leukemia cell lines lacking the normal allele. | ||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 1 | 1 | M → T: Abolishes expression of A-type isoforms | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 27 | 1 | M → T: Abolishes expression of B-type isoforms | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 191 | 1 | F → D: Reduces transactivation by the ADA complex | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 193 | 1 | I → D: Reduces transactivation by the ADA complex | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 194 | 1 | L → A: Strongly reduces transactivation by the ADA complex; when associated with V-224 and F-225 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 197 | 1 | L → E: Reduces transactivation by the ADA complex | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 213 | 1 | W → A: Strongly reduces transactivation by the ADA complex | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 224 | 1 | L → V: Strongly reduces transactivation by the ADA complex; when associated with A-194 and F-225 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 225 | 1 | L → F: Strongly reduces transactivation by the ADA complex; when associated with A-194 and V-224 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 235 | 1 | F → L: Strongly reduces transactivation by the ADA complex; when associated with V-236 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 236 | 1 | L → V: Strongly reduces transactivation by the ADA complex; when associated with L-235 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 277 | 1 | K → R: Strongly reduces sumoylation. Almost complete loss of sumoylation; when associated with R-293 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 293 | 1 | K → R: Strongly reduces sumoylation. Almost complete loss of sumoylation; when associated with R-277 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 585 | 1 | R → A: Reduces activation mediated by ligand binding domain; when associated with A-590 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 590 | 1 | D → A: Reduces activation mediated by ligand binding domain; when associated with A-585 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 602 | 1 | F → S: Increases solubility. No effect on transactivation by dexamethasone | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 625 | 1 | P → A: Decreases transactivation by dexamethasone by 95% | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 628 | 1 | I → A: Decreases dimerization and transactivation by dexamethasone; when associated with S-602 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 703 | 1 | K → R: Slightly reduces sumoylation | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 399 | 1 | R → G in BAD97314. Ref.5 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 754 | 1 | A → T in BAD97314. Ref.5 | ||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Helix | 532 – 539 | 8 | |||||||||||||||||||||||||||||||||||||
| Helix | 556 – 578 | 23 | |||||||||||||||||||||||||||||||||||||
| Helix | 584 – 586 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 589 – 616 | 28 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 619 – 624 | 6 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 627 – 629 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 633 – 635 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 639 – 655 | 17 | |||||||||||||||||||||||||||||||||||||
| Helix | 660 – 671 | 12 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 673 – 676 | 4 | |||||||||||||||||||||||||||||||||||||
| Helix | 683 – 704 | 22 | |||||||||||||||||||||||||||||||||||||
| Helix | 709 – 732 | 24 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 735 – 739 | 5 | |||||||||||||||||||||||||||||||||||||
| Helix | 740 – 746 | 7 | |||||||||||||||||||||||||||||||||||||
| Helix | 749 – 757 | 9 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 769 – 771 | 3 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||

Clusters with