Reviewed,
UniProtKB/Swiss-Prot P26006 (ITA3_HUMAN)
Last modified
September 2, 2008.
Version 94.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Integrin alpha-3 Alternative name(s): Galactoprotein B3 Short name=GAPB3 VLA-3 alpha chain FRP-2 CD49 antigen-like family member C CD_antigen=CD49c Cleaved into the following 2 chains: 1- Recommended name: Integrin alpha-3 heavy chain 2- Recommended name: Integrin alpha-3 light chain | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1066 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration. |
| Subunit structure | Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5. |
| Subcellular location | |
| Tissue specificity | Isoform alpha-3A is widely expressed. Isoform alpha-3B is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform alpha-3A is strongly expressed on vascular smooth muscle cells, isoform alpha-3B is detected only on endothelial vein cells. |
| Post-translational modification | Isoform alpha-3A, but not isoform alpha-3B, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12-myristate 13-acetate stimulation. Isoform alpha-3A is phosphorylated on Tyr-1051. |
| Sequence similarities | Belongs to the integrin alpha chain family. Contains 7 FG-GAP repeats. |
Ontologies
Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal Transmembrane |
| Ligand | Calcium |
| Molecular function | Integrin Receptor |
| PTM | Cleavage on pair of basic residues Glycoprotein Phosphoprotein |
| Technical term | Direct protein sequencing |
Gene Ontology (GO) | |
| Biological process | cell-matrix adhesion Ref.1 Traceable author statement. Source: ProtInc |
| Cellular component | integrin complex Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | protein binding Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform Alpha-3B (identifier: P26006-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform Alpha-3A (identifier: P26006-2) The sequence of this isoform differs from the canonical sequence as follows: 1022-1066: TRYYQIMPKYHAVRIREEERYPPPGSTLPTKKHWVTSWQTRDQYY → ARTRALYEAKRQKAEMKSQPSETERLTDDY | |||||
| Notes: Phosphorylated on Tyr-1051. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||||
Molecule processing | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 32 | 32 | ||||||||
| Chain | 33 – 1066 | 1034 | Integrin alpha-3 | |||||||
| Chain | 33 – 872 | 840 | Integrin alpha-3 heavy chain Potential | |||||||
| Chain | 876 – 1066 | 191 | Integrin alpha-3 light chain Potential | |||||||
Regions | ||||||||||
| Topological domain | 33 – 991 | 959 | Extracellular Potential | |||||||
| Transmembrane | 992 – 1014 | 23 | Potential | |||||||
| Topological domain | 1015 – 1066 | 52 | Cytoplasmic Potential | |||||||
| Repeat | 49 – 94 | 46 | FG-GAP 1 | |||||||
| Repeat | 120 – 165 | 46 | FG-GAP 2 | |||||||
| Repeat | 195 – 227 | 33 | FG-GAP 3 | |||||||
| Repeat | 246 – 279 | 34 | FG-GAP 4 | |||||||
| Repeat | 304 – 345 | 42 | FG-GAP 5 | |||||||
| Repeat | 366 – 402 | 37 | FG-GAP 6 | |||||||
| Repeat | 426 – 461 | 36 | FG-GAP 7 | |||||||
| Calcium binding | 315 – 323 | 9 | Potential | |||||||
| Calcium binding | 378 – 386 | 9 | Potential | |||||||
| Calcium binding | 439 – 447 | 9 | Potential | |||||||
| Region | 1015 – 1021 | 7 | Interaction with HPS5 | |||||||
| Motif | 1017 – 1021 | 5 | GFFKR motif | |||||||
Amino acid modifications | ||||||||||
| Glycosylation | 86 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 107 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 265 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 500 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 511 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 573 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 605 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 656 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 697 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 841 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 857 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 926 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 935 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Glycosylation | 969 | 1 | N-linked (GlcNAc...) Potential | |||||||
| Disulfide bond | 94 ↔ 103 | |||||||||
| Disulfide bond | 140 ↔ 162 | |||||||||
| Disulfide bond | 185 ↔ 197 | |||||||||
| Disulfide bond | 485 ↔ 490 | By similarity | ||||||||
| Disulfide bond | 496 ↔ 550 | By similarity | ||||||||
| Disulfide bond | 615 ↔ 621 | |||||||||
| Disulfide bond | 694 ↔ 702 | |||||||||
| Disulfide bond | 846 ↔ 904 | Interchain (between heavy and light chains) | ||||||||
| Disulfide bond | 911 ↔ 916 | |||||||||
Natural variations | ||||||||||
| Alternative sequence | 1022 – 1066 | 45 | TRYYQ…RDQYY → ARTRALYEAKRQKAEMKSQP SETERLTDDY in isoform Alpha-3A. | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and expression of the cDNA for alpha 3 subunit of human alpha 3 beta 1 (VLA-3), an integrin receptor for fibronectin, laminin, and collagen." Takada Y., Murphy E., Pil P., Chen C., Ginsberg M.H., Hemler M.E. J. Cell Biol. 115:257-266(1991) [PubMed: 1655803] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-3A AND ALPHA-3B). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA-3A). Tissue: Hippocampus. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA-3A). |
| [5] | "Identification of human galactoprotein b3, an oncogenic transformation-induced membrane glycoprotein, as VLA-3 alpha subunit: the primary structure of human integrin alpha 3." Tsuji T., Hakomori S., Osawa T. J. Biochem. 109:659-665(1991) [PubMed: 1714443] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-1066 (ISOFORM ALPHA-3A). Tissue: Fibroblast. |
| [6] | "Molecular and biological characterization of fusion regulatory proteins (FRPs): anti-FRP mAbs induced HIV-mediated cell fusion via an integrin system." Ohta H., Tsurudome M., Matsumura H., Koga Y., Morikawa S., Kawano M., Kusugawa S., Komada H., Nishio M., Ito Y. EMBO J. 13:2044-2055(1994) [PubMed: 8187758] [Abstract] Cited for: PROTEIN SEQUENCE OF 33-49. |
| [7] | "The very late antigen family of heterodimers is part of a superfamily of molecules involved in adhesion and embryogenesis." Takada Y., Strominger J.L., Hemler M.E. Proc. Natl. Acad. Sci. U.S.A. 84:3239-3243(1987) [PubMed: 3033641] [Abstract] Cited for: PROTEIN SEQUENCE OF 33-46. |
| [8] | "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization." de Melker A.A., Sterk L.M., Delwel G.O., Fles D.L., Daams H., Weening J.J., Sonnenberg A. Lab. Invest. 76:547-563(1997) [PubMed: 9111516] [Abstract] Cited for: ALTERNATIVE SPLICING, PHOSPHORYLATION, TISSUE SPECIFICITY. |
| [9] | "Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains." Krokhin O.V., Cheng K., Sousa S.L., Ens W., Standing K.G., Wilkins J.A. Biochemistry 42:12950-12959(2003) [PubMed: 14596610] [Abstract] Cited for: DISULFIDE BONDS. |
| [10] | "NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin." Fukushi J., Makagiansar I.T., Stallcup W.B. Mol. Biol. Cell 15:3580-3590(2004) [PubMed: 15181153] [Abstract] Cited for: INTERACTION WITH ITGB1; LGALS3 AND CSPG4, FUNCTION. |
| [11] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1051 (ISOFORM ALPHA-3A), MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| M59911 mRNA. Translation: AAA36120.1. AK289961 mRNA. Translation: BAF82650.1. CH471109 Genomic DNA. Translation: EAW94645.1. BC150190 mRNA. Translation: AAI50191.1. D01038 mRNA. Translation: BAA00845.1. | |
| PIR | A40021. |
| UniGene | Hs.265829 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1A8X based on UniProtKB P11215. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP:140N. |
Genome annotation databases | |
| Ensembl | ENSG00000005884. Homo sapiens. [Contig view] |
Organism-specific databases | |
| H-InvDB | HIX0017318. |
| HGNC | HGNC:6139. ITGA3. |
| MIM | 605025. gene. |
| PharmGKB | PA29939. |
| GenAtlas | Search... |

Clusters with