Reviewed,
UniProtKB/Swiss-Prot P30307 (MPIP3_HUMAN)
Last modified
October 14, 2008.
Version 90.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: M-phase inducer phosphatase 3 EC=3.1.3.48 Alternative name(s): Dual specificity phosphatase Cdc25C | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 473 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Functions as a dosage-dependent inducer in mitotic control. It is a tyrosine protein phosphatase required for progression of the cell cycle. It directly dephosphorylates CDC2 and activate its kinase activity. |
| Catalytic activity | Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate. |
| Subunit structure | Interacts with HIV-1 Vpr, thereby inactivating CDC25C phosphatase activity. |
| Subcellular location | |
| Developmental stage | Expressed predominantly in G2 phase. |
| Post-translational modification | Phosphorylated by CHK1 on Ser-216. This phosphorylation creates a binding site for 14-3-3 protein and inhibits the phosphatase. |
| Sequence similarities | Belongs to the MPI phosphatase family. Contains 1 rhodanese domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDC2 | P06493 | 1 | EBI-974439,EBI-444308 | |
| CHEK1 | O14757 | 1 | EBI-974439,EBI-974488 | |
| LZTS1 | Q9Y250 | 1 | EBI-974439,EBI-1216080 | |
| PPP2R5D | Q14738 | 1 | EBI-974439,EBI-396563 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: P30307-1) Also known as: CDC25C1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: P30307-2) Also known as: CDC25C2; The sequence of this isoform differs from the canonical sequence as follows: 124-153: Missing. | |||||
| Isoform 3 (identifier: P30307-5) Also known as: CDC25C3; The sequence of this isoform is not available. | |||||
| Isoform 4 (identifier: P30307-3) Also known as: CDC25C4; The sequence of this isoform differs from the canonical sequence as follows: 66-123: GTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSP → SPGFFRTSGSAFSWD | |||||
| Isoform 5 (identifier: P30307-4) Also known as: CDC25C5; Cdc25Cdm; The sequence of this isoform differs from the canonical sequence as follows: 66-123: GTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSP → SPGFFRTSGSAFSWD 124-153: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||||
Molecule processing | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 473 | 473 | M-phase inducer phosphatase 3 | |||||||
Regions | ||||||||||
| Domain | 321 – 428 | 108 | Rhodanese | |||||||
| Region | 334 – 379 | 46 | HIV-1 Vpr binding site | |||||||
Sites | ||||||||||
| Active site | 377 | 1 | By similarity | |||||||
Amino acid modifications | ||||||||||
| Modified residue | 168 | 1 | Phosphoserine | |||||||
| Modified residue | 216 | 1 | Phosphoserine; by CHK1, CHK2 and BRSK1 | |||||||
Natural variations | ||||||||||
| Alternative sequence | 66 – 123 | 58 | GTPKR…MKCSP → SPGFFRTSGSAFSWD in isoform 4 and isoform 5. | |||||||
| Alternative sequence | 124 – 153 | 30 | Missing in isoform 2 and isoform 5. | |||||||
| Natural variant | 14 | 1 | S → N: dbSNP rs11567959. | |||||||
| Natural variant | 70 | 1 | R → C: dbSNP rs3734166. | |||||||
| Natural variant | 78 | 1 | S → N: dbSNP rs11567962. | |||||||
| Natural variant | 297 | 1 | G → R: dbSNP rs11567997. | |||||||
Experimental info | ||||||||||
| Mutagenesis | 352 | 1 | E → K: Partial loss of HIV-1 Vpr binding | |||||||
| Mutagenesis | 359 | 1 | K → E: No effect on HIV-1 Vpr binding | |||||||
Secondary structure | ||||||||||
Helix Strand Turn | ||||||||||
| Beta strand | 127 – 129 | 3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human homolog of fission yeast cdc25 mitotic inducer is predominantly expressed in G2." Sadhu K., Reed B.I., Richardson H., Russell P. Proc. Natl. Acad. Sci. U.S.A. 87:5139-5143(1990) [PubMed: 2195549] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT CYS-70. |
| [2] | "An additional transcript of the cdc25C gene from A431 cells encodes a functional protein." Bureik M., Rief N., Drescher R., Jungbluth A., Montenarh M., Wagner P. Int. J. Oncol. 17:1251-1258(2000) [PubMed: 11078813] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). |
| [3] | "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Department of Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)." Livingston R.J., Rieder M.J., Chung M.-W., Ritchie T.K., Olson A.N., Nguyen C.P., Nguyen D.A., Poel C.L., Robertson P.D., Schackwitz W.S., Sherwood J.K., Sherwood A.M., Leithauser B.J., Nickerson D.A. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT CYS-70. Tissue: Skin. |
| [5] | "Alternative splicing in the regulatory region of the human phosphatases CDC25A and CDC25C." Wegener S., Hampe W., Herrmann D., Schaller H.C. Eur. J. Cell Biol. 79:810-815(2000) [PubMed: 11139144] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 32-210 (ISOFORMS 2; 4 AND 5), VARIANT CYS-70. |
| [6] | "Differential expression of cdc25 cell-cycle-activating phosphatases in human colorectal carcinoma." Hernandez S., Bessa X., Bea S., Hernandez L., Nadal A., Mallofre C., Muntane J., Castells A., Fernandez P.L., Cardesa A., Campo E. Lab. Invest. 81:465-473(2001) [PubMed: 11304565] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). Tissue: Colon carcinoma. |
| [7] | "Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function." Lu R., Niida H., Nakanishi M. J. Biol. Chem. 279:31164-31170(2004) [PubMed: 15150265] [Abstract] Cited for: PHOSPHORYLATION AT SER-216. Tissue: Testis. |
| [8] | "The human immunodeficiency virus Vpr protein binds Cdc25C: implications for G2 arrest." Goh W.C., Manel N., Emerman M. Virology 318:337-349(2004) [PubMed: 14972559] [Abstract] Cited for: INTERACTION WITH HIV-1 VPR, MUTAGENESIS OF GLU-352 AND LYS-359. |
| [9] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168, MASS SPECTROMETRY. Tissue: Epithelium. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M34065 mRNA. Translation: AAA35666.1. AJ304504 mRNA. Translation: CAC19192.1. AY497474 Genomic DNA. Translation: AAR32098.1. BC019089 mRNA. Translation: AAH19089.1. AF277723 mRNA. Translation: AAG41885.1. AF277725 mRNA. Translation: AAG41887.1. AF277726 mRNA. Translation: AAG41888.1. AF312681 mRNA. Translation: AAL26835.1. | |||||||||||||
| PIR | A38874. I59168. | ||||||||||||
| RefSeq | NP_001781.2. NP_073720.1. | ||||||||||||
| UniGene | Hs.656 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP:24183N. | ||||||||||||
| IntAct | P30307. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P30307. | ||||||||||||
Polymorphism databases | |||||||||||||
| NIEHS-SNPs | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000158402. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 995. | ||||||||||||
| KEGG | hsa:995. | ||||||||||||
Organism-specific databases | |||||||||||||
| H-InvDB | HIX0005209. | ||||||||||||
| HGNC | HGNC:1727. CDC25C. | ||||||||||||
| HPA | CAB003800. | ||||||||||||
| MIM | 157680. gene. | ||||||||||||
| PharmGKB | PA100. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
| GeneCards | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | P30307. | ||||||||||||
| HOVERGEN | P30307. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_152. Cell Cycle, Mitotic. REACT_1538. Cell Cycle Checkpoints. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P30307. | ||||||||||||
| CleanEx | HS_CDC25C. | ||||||||||||
| GermOnline | ENSG00000158402. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000751. MPI_Phosphatase. IPR001763. Rhodanese-like. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.40.250.10. Rhodanese-like. 1 hit. | ||||||||||||
| PANTHER | PTHR10828. MPI_Phosphatase. 1 hit. | ||||||||||||
| Pfam | PF06617. M-inducer_phosp. 1 hit. PF00581. Rhodanese. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00716. MPIPHPHTASE. | ||||||||||||
| SMART | SM00450. RHOD. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50206. RHODANESE_3. 1 hit. [Graphical view] | ||||||||||||
| BLOCKS | Search... | ||||||||||||
Other Resources | |||||||||||||
| SOURCE | Search... | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Entry information
| Entry name | MPIP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P30307 Secondary accession number(s): Q96PL3 Q9H2F1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


