Reviewed,
UniProtKB/Swiss-Prot P55265 (DSRAD_HUMAN)
Last modified
July 22, 2008.
Version 98.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Double-stranded RNA-specific adenosine deaminase Short name(s)=DRADA EC=3.5.4.- Alternative name(s): 136 kDa double-stranded RNA-binding protein P136 K88DSRBP Interferon-inducible protein 4 Short name(s)=IFI-4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1226 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Converts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. Has been found to modify more frequently adenosines in AU-rich regions, probably due to the relative ease of melting A/U base pairs as compared to G/C pairs. Functions to modify viral RNA genomes and may be responsible for hypermutation of certain negative-stranded viruses. Edits the messenger RNAs for glutamate receptor (GLUR) subunits by site-selective adenosine deamination. Produces low-level editing at the GLUR-B Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. Binds to ILF3/NF90 and up-regulates ILF3-mediated gene expression. |
| Subunit structure | Homodimer. Isoform 1 interacts with ILF2/NF45 and ILF3/NF90. |
| Subcellular location | Cytoplasm. Nucleus › nucleolus. Note= Isoform 1 is found predominantly in cytoplasm but appears to shuttle between the cytoplasm and nucleus. Isoform 5 is found exclusively in the nucleolus. |
| Tissue specificity | Ubiquitously expressed, highest levels were found in brain and lung. |
| Induction | Isoform 1 is induced by interferon alpha. Isoform 5 is constitutively expressed. |
| Post-translational modification | Sumoylation reduces RNA-editing activity. |
| Involvement in disease | Defects in ADAR are a cause of dyschromatosis symmetrical hereditaria (DSH) [MIM:127400]; also known as reticulate acropigmentation of Dohi. DSH is a pigmentary genodermatosis of autosomal dominant inheritance characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the dorsal parts of the hands and feet. |
| Sequence similarities | Contains 1 A to I editase domain. Contains 2 DRADA repeats. Contains 3 DRBM (double-stranded RNA-binding) domains. |
| Caution | The N-terminus of isoform 4 has been derived from EST and genomic sequences. |
Ontologies
Keywords | |
|---|---|
| Biological process | RNA-mediated gene silencing mRNA processing |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative promoter usage Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Repeat |
| Ligand | DNA-binding Metal-binding RNA-binding Zinc |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein Ubl conjugation |
| Technical term | 3D-structure Direct protein sequencing |
Gene Ontology (GO) | |
| Biological process | base conversion or substitution editing Ref.3 Inferred from direct assay. Source: MGI |
| Cellular component | cytoplasm Ref.2 Traceable author statement. Source: UniProtKB nucleus Ref.2Traceable author statement. Source: UniProtKB |
| Molecular function | double-stranded RNA adenosine deaminase activity Ref.2 Ref.3 Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: P55265-1) Also known as: ADAR-a; p150; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Notes: Produced by alternative promoter usage. | |||||
| Isoform 2 (identifier: P55265-2) Also known as: ADAR-b; The sequence of this isoform differs from the canonical sequence as follows: 807-832: Missing. | |||||
| Notes: Produced by alternative splicing of isoform 1. | |||||
| Isoform 3 (identifier: P55265-3) Also known as: ADAR-c; The sequence of this isoform differs from the canonical sequence as follows: 694-712: Missing. 807-832: Missing. | |||||
| Notes: Produced by alternative splicing of isoform 1. | |||||
| Isoform 4 (identifier: P55265-4) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MNPRQ → MMSPICDQTIDSRLKVEKATWWGRVGGGSRPHWQPPGVRPCPEEVQDP | |||||
| Notes: Produced by alternative splicing of isoform 1. No experimental confirmation available. The N-terminus has been derived from EST and genomic sequences. | |||||
| Isoform 5 (identifier: P55265-5) The sequence of this isoform differs from the canonical sequence as follows: 1-295: Missing. | |||||
| Notes: Produced by alternative promoter usage. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1226 | 1226 | Double-stranded RNA-specific adenosine deaminase | |||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||
| Repeat | 133 – 202 | 70 | DRADA 1 | |||||||||||||||||||||||||||||||||
| Repeat | 293 – 360 | 68 | DRADA 2 | |||||||||||||||||||||||||||||||||
| Domain | 503 – 571 | 69 | DRBM 1 | |||||||||||||||||||||||||||||||||
| Domain | 614 – 682 | 69 | DRBM 2 | |||||||||||||||||||||||||||||||||
| Domain | 726 – 794 | 69 | DRBM 3 | |||||||||||||||||||||||||||||||||
| Domain | 886 – 1221 | 336 | A to I editase | |||||||||||||||||||||||||||||||||
| DNA binding | 169 – 195 | 27 | ||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||
| Active site | 912 | 1 | Proton donor By similarity | |||||||||||||||||||||||||||||||||
| Metal binding | 910 | 1 | Zinc By similarity | |||||||||||||||||||||||||||||||||
| Metal binding | 966 | 1 | Zinc By similarity | |||||||||||||||||||||||||||||||||
| Metal binding | 1036 | 1 | Zinc By similarity | |||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||
| Modified residue | 808 | 1 | Phosphothreonine | |||||||||||||||||||||||||||||||||
| Modified residue | 818 | 1 | Phosphothreonine | |||||||||||||||||||||||||||||||||
| Modified residue | 825 | 1 | Phosphoserine | |||||||||||||||||||||||||||||||||
| Cross-link | 418 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 295 | 295 | Missing in isoform 5. | |||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MNPRQ → MMSPICDQTIDSRLKVEKAT WWGRVGGGSRPHWQPPGVRP CPEEVQDP in isoform 4. | |||||||||||||||||||||||||||||||||
| Alternative sequence | 694 – 712 | 19 | Missing in isoform 3. | |||||||||||||||||||||||||||||||||
| Alternative sequence | 807 – 832 | 26 | Missing in isoform 2 and isoform 3. | |||||||||||||||||||||||||||||||||
| Natural variant | 384 | 1 | R → K: dbSNP rs2229857. | |||||||||||||||||||||||||||||||||
| Natural variant | 587 | 1 | Y → C: dbSNP rs17843865. | |||||||||||||||||||||||||||||||||
| Natural variant | 806 | 1 | E → V in a breast cancer sample; somatic mutation. | |||||||||||||||||||||||||||||||||
| Natural variant | 923 | 1 | L → P in DSH. | |||||||||||||||||||||||||||||||||
| Natural variant | 966 | 1 | C → F in DSH. | |||||||||||||||||||||||||||||||||
| Natural variant | 1155 | 1 | R → W in DSH. | |||||||||||||||||||||||||||||||||
| Natural variant | 1165 | 1 | F → S in DSH. | |||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 418 | 1 | K → R: Abolishes sumoylation | |||||||||||||||||||||||||||||||||
| Sequence conflict | 53 | 1 | E → G in CAA55967 and CAA55968. Ref.4 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 1184 | 1 | E → K in CAA55967 and CAA55968. Ref.4 | |||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||
| Helix | 127 – 130 | 4 | ||||||||||||||||||||||||||||||||||
| Helix | 135 – 150 | 16 | ||||||||||||||||||||||||||||||||||
| Helix | 158 – 165 | 8 | ||||||||||||||||||||||||||||||||||
| Helix | 169 – 181 | 13 | ||||||||||||||||||||||||||||||||||
| Beta strand | 184 – 192 | 9 | ||||||||||||||||||||||||||||||||||
| Beta strand | 194 – 197 | 4 | ||||||||||||||||||||||||||||||||||
| Helix | 294 – 309 | 16 | ||||||||||||||||||||||||||||||||||
| Helix | 315 – 322 | 8 | ||||||||||||||||||||||||||||||||||
| Helix | 324 – 326 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 327 – 339 | 13 | ||||||||||||||||||||||||||||||||||
| Beta strand | 342 – 346 | 5 | ||||||||||||||||||||||||||||||||||
| Beta strand | 348 – 350 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 352 – 355 | 4 | ||||||||||||||||||||||||||||||||||
| Helix | 357 – 360 | 4 | ||||||||||||||||||||||||||||||||||
| Turn | 361 – 363 | 3 | ||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of cDNA for double-stranded RNA adenosine deaminase, a candidate enzyme for nuclear RNA editing." Kim U., Wang Y., Sanford T., Zeng Y., Nishikura K. Proc. Natl. Acad. Sci. U.S.A. 91:11457-11461(1994) [PubMed: 7972084] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. |
| [2] | "Expression and regulation by interferon of a double-stranded-RNA-specific adenosine deaminase from human cells: evidence for two forms of the deaminase." Patterson J.B., Samuel C.E. Mol. Cell. Biol. 15:5376-5388(1995) [PubMed: 7565688] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Kidney. |
| [3] | "Functionally distinct double-stranded RNA-binding domains associated with alternative splice site variants of the interferon-inducible double-stranded RNA-specific adenosine deaminase." Liu Y., George C.X., Patterson J.B., Samuel C.E. J. Biol. Chem. 272:4419-4428(1997) [PubMed: 9020165] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Placenta. |
| [4] | "The gene coding for the interferon-inducible human dsRNA adenosine deaminase is transcribed into several messengers specifying different proteins." Deblandre G., Marinx O., Nols C., Defrance P., Berr P., Huez G., Caput D. Submitted (JUN-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Cervix carcinoma. |
| [5] | The German cDNA consortium Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Amygdala and Fetal kidney. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lymph. |
| [7] | "Human RNA-specific adenosine deaminase ADAR1 transcripts possess alternative exon 1 structures that initiate from different promoters, one constitutively active and the other interferon inducible." George C.X., Samuel C.E. Proc. Natl. Acad. Sci. U.S.A. 96:4621-4626(1999) [PubMed: 10200312] [Abstract] Cited for: ALTERNATIVE PROMOTER USAGE, INDUCTION. |
| [8] | "Requirement of dimerization for RNA editing activity of adenosine deaminases acting on RNA." Cho D.-S.C., Yang W., Lee J.T., Shiekhattar R., Murray J.M., Nishikura K. J. Biol. Chem. 278:17093-17102(2003) [PubMed: 12618436] [Abstract] Cited for: HOMODIMERIZATION. |
| [9] | "Dynamic association of RNA-editing enzymes with the nucleolus." Desterro J.M.P., Keegan L.P., Lafarga M., Berciano M.T., O'Connell M., Carmo-Fonseca M. J. Cell Sci. 116:1805-1818(2003) [PubMed: 12665561] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [10] | "ADAR1 RNA deaminase limits short interfering RNA efficacy in mammalian cells." Yang W., Wang Q., Howell K.L., Lee J.T., Cho D.-S.C., Murray J.M., Nishikura K. J. Biol. Chem. 280:3946-3953(2005) [PubMed: 15556947] [Abstract] Cited for: FUNCTION. |
| [11] | "SUMO-1 modification alters ADAR1 editing activity." Desterro J.M.P., Keegan L.P., Jaffray E., Hay R.T., O'Connell M.A., Carmo-Fonseca M. Mol. Biol. Cell 16:5115-5126(2005) [PubMed: 16120648] [Abstract] Cited for: SUMOYLATION AT LYS-418, MUTAGENESIS OF LYS-418. |
| [12] | "ADAR1 interacts with NF90 through double-stranded RNA and regulates NF90-mediated gene expression independently of RNA editing." Nie Y., Ding L., Kao P.N., Braun R., Yang J.-H. |

Clusters with