Reviewed,
UniProtKB/Swiss-Prot P78348 (ACCN2_HUMAN)
Last modified
July 22, 2008.
Version 75.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Amiloride-sensitive cation channel 2, neuronal Alternative name(s): Acid-sensing ion channel 1 Short name=ASIC1 Brain sodium channel 2 BNaC2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 528 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Ca(2+), Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Mediates glutamate-independent Ca(2+) entry into neurons upon acidosis. This Ca(2+) overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Functions as a postsynaptic proton receptor that influences intracellular Ca(2+) concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. Modulates activity in the circuits underlying innate fear By similarity. |
| Subunit structure | Homotetramer or heterotetramer with other ASIC proteins Probable. Interacts with STOM and ACCN1 By similarity. Interacts with PRKCABP. |
| Subcellular location | Cell membrane; Multi-pass membrane proteinBy similarity. Note= Localizes in synaptosomes at dendritic synapses of neurons. Colocalizes with DLG4 By similarity. |
| Tissue specificity | Expressed in most or all neurons. |
| Post-translational modification | Phosphorylation by PKA regulates interaction with PRKCABP and subcellular location. Phosphorylation by PKC may regulate the channel. |
| Miscellaneous | Potentiated by Ca(2+), Mg(2+), Ba(2+) and multivalent cations. Inhibited by anti-inflammatory drugs like salicylic acid By similarity. Potentiated by FMRFamide-related neuropeptides. PH dependence may be regulated by serine proteases. |
| Sequence similarities | Belongs to the amiloride-sensitive sodium channel family. |
Ontologies
Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Sodium transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane |
| Ligand | Calcium Sodium |
| Molecular function | Ionic channel Sodium channel |
| PTM | Glycoprotein Phosphoprotein |
Gene Ontology (GO) | |
| Biological process | response to pH Traceable author statement. Source: ProtInc signal transduction Ref.1Traceable author statement. Source: ProtInc sodium ion transport Ref.1Non-traceable author statement. Source: UniProtKB |
| Cellular component | integral to plasma membrane Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | amiloride-sensitive sodium channel activity Non-traceable author statement. Source: UniProtKB protein binding Ref.4Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Notes: The splice variant from ASIC1a described in mouse and rat, which gives rise to an isoform with different N-termini (Asic1b), does not seem to exist in human. | |||||
| Isoform 2 (identifier: P78348-2) Also known as: Asic1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 1 (identifier: P78348-1) The sequence of this isoform differs from the canonical sequence as follows: 433-433: G → GELLMTPVPFSCHGHGVAPYHPKAGCSLLSHEGPPPQRPFPKPCCLG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 528 | 528 | Amiloride-sensitive cation channel 2, neuronal | |||||
Regions | ||||||||
| Topological domain | 1 – 44 | 44 | Cytoplasmic Potential | |||||
| Transmembrane | 45 – 65 | 21 | Potential | |||||
| Topological domain | 66 – 427 | 362 | Extracellular Potential | |||||
| Transmembrane | 428 – 448 | 21 | Potential | |||||
| Topological domain | 449 – 528 | 80 | Cytoplasmic Potential | |||||
Amino acid modifications | ||||||||
| Modified residue | 479 | 1 | Phosphoserine; by PKA | |||||
| Glycosylation | 368 | 1 | N-linked (GlcNAc...) Potential | |||||
| Glycosylation | 395 | 1 | N-linked (GlcNAc...) Potential | |||||
Natural variations | ||||||||
| Alternative sequence | 433 | 1 | G → GELLMTPVPFSCHGHGVAPY HPKAGCSLLSHEGPPPQRPF PKPCCLG in isoform 1. | |||||
Experimental info | ||||||||
| Mutagenesis | 478 | 1 | S → A: No effect on phosphorylation | |||||
| Mutagenesis | 479 | 1 | S → A: Loss of phosphorylation | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "BNaC1 and BNaC2 constitute a new family of human neuronal sodium channels related to degenerins and epithelial sodium channels." Garcia-Anoveros J., Derfler B.H., Neville-Golden J., Hyman B.T., Corey D.P. Proc. Natl. Acad. Sci. U.S.A. 94:1459-1464(1997) [PubMed: 9037075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 231-528 (ISOFORM 1). Tissue: Ovary. |
| [3] | "Neuropeptide FF and FMRFamide potentiate acid-evoked currents from sensory neurons and proton-gated DEG/ENaC channels." Askwith C.C., Cheng C., Ikuma M., Benson C., Price M.P., Welsh M.J. Neuron 26:133-141(2000) [PubMed: 10798398] [Abstract] Cited for: REGULATION BY FMRFAMIDE-RELATED PEPTIDES. |
| [4] | "Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel)." Hruska-Hageman A.M., Wemmie J.A., Price M.P., Welsh M.J. Biochem. J. 361:443-450(2002) [PubMed: 11802773] [Abstract] Cited for: INTERACTION WITH PRKCABP. |
| [5] | "Protein kinase C isoform antagonism controls BNaC2 (ASIC1) function." Berdiev B.K., Xia J., Jovov B., Markert J.M., Mapstone T.B., Gillespie G.Y., Fuller C.M., Bubien J.K., Benos D.J. J. Biol. Chem. 277:45734-45740(2002) [PubMed: 12244121] [Abstract] Cited for: PHOSPHORYLATION BY PKC. |
| [6] | "cAMP-dependent protein kinase phosphorylation of the acid-sensing ion channel-1 regulates its binding to the protein interacting with C-kinase-1." Leonard A.S., Yermolaieva O., Hruska-Hageman A., Askwith C.C., Price M.P., Wemmie J.A., Welsh M.J. Proc. Natl. Acad. Sci. U.S.A. 100:2029-2034(2003) [PubMed: 12578970] [Abstract] Cited for: PHOSPHORYLATION BY PKA, MUTAGENESIS OF SER-478 AND SER-479, PHOSPHORYLATION AT SER-479, INTERACTION WITH PRKCABP, SUBCELLULAR LOCATION. |
| [7] | "Selective regulation of acid-sensing ion channel 1 by serine proteases." Poirot O., Vukicevic M., Boesch A., Kellenberger S. J. Biol. Chem. 279:38448-38457(2004) [PubMed: 15247234] [Abstract] Cited for: REGULATION BY SERINE PROTEASES. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U78180 mRNA. Translation: AAB48980.1. U78181 mRNA. Translation: AAB48981.1. BC013891 mRNA. Translation: AAH13891.2. | |
| RefSeq | NP_001086.2. NP_064423.2. |
| UniGene | Hs.274361 Hs.647113 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P78348. |
Genome annotation databases | |
| Ensembl | ENSG00000110881. Homo sapiens. [Contig view] |
| GeneID | 41. |
| KEGG | hsa:41. |
Organism-specific databases | |
| H-InvDB | HIX0036785. |
| HGNC | HGNC:100. ACCN2. |
| MIM | 602866. gene. |
| PharmGKB | PA24434. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOVERGEN | P78348. |
Gene expression databases | |
| CleanEx | HS_ACCN2. |
Family and domain databases | |
| InterPro | IPR004724. EnaC. IPR001873. Na+channel_ASC. [Graphical view] |
| PANTHER | PTHR11690. Na+channel_ASC. 1 hit. |
| Pfam | PF00858. ASC. 1 hit. [Graphical view] |
| PRINTS | PR01078. AMINACHANNEL. |
| TIGRFAMs | TIGR00859. ENaC. 1 hit. |
| PROSITE | PS01206. ASC. 1 hit. [Graphical view] |
| ProDom | P78348. [Graphical view] [Entries sharing at least one domain] |
| BLOCKS | Search... |
Other Resources | |
| DrugBank | DB00594. Amiloride. |
| SOURCE | Search... |
| ProtoNet | Search... |
Entry information
| Entry name | ACCN2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P78348 Secondary accession number(s): P78349, Q96CV2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


