Reviewed,
UniProtKB/Swiss-Prot Q13085 (ACACA_HUMAN)
Last modified
November 25, 2008.
Version 87.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Acetyl-CoA carboxylase 1 EC=6.4.1.2 Alternative name(s): ACC-alpha Including the following 1 domains: 1- Recommended name: Biotin carboxylase EC=6.3.4.14 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2346 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase. |
| Catalytic activity | ATP + acetyl-CoA + HCO(3)(-) = ADP + phosphate + malonyl-CoA. ATP + biotin-carboxyl-carrier protein + CO(2) = ADP + phosphate + carboxybiotin-carboxyl-carrier protein. |
| Cofactor | Biotin. Binds 2 manganese ions per subunit. |
| Enzyme regulation | By phosphorylation By similarity. |
| Pathway | Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA from acetyl-CoA: step 1/1. |
| Subunit structure | Interacts in its inactive phosphorylated form with the BRCT domains of BRCA1 which prevents ACACA dephosphorylation and inhibits lipid synthesis. |
| Subcellular location | |
| Tissue specificity | Expressed in brain, placental, skeletal muscle, renal, pancreatic and adipose tissues; expressed at low level in pulmonary tissue; not detected in the liver. |
| Post-translational modification | Phosphorylation on Ser-1263 is required for interaction with BRCA1. |
| Involvement in disease | Defects in ACACA are a cause of ACACA deficiency [MIM:200350]; also called ACAC or ACC deficiency. ACACA deficiency is an inborn error of de novo fatty acid synthesis. The disorder is associated with severe brain damage, persistent myopathy and poor growth. |
| Sequence similarities | Contains 1 ATP-grasp domain. Contains 1 biotin carboxylation domain. Contains 1 biotinyl-binding domain. Contains 1 carboxyltransferase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| AKR1B10 | O60218 | 3 | EBI-717681,EBI-1572139 | |
| BRCA1 | P38398 | 2 | EBI-717681,EBI-349905 |
Alternative products
| This entry describes 4 isoforms produced by alternative promoter usage. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13085-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13085-2) Also known as: E5A; The sequence of this isoform differs from the canonical sequence as follows: 1-75: MDEPSPLAQP...SLQDGLALHI → MEGSPEENKEMRYYMLQ | ||||||
| Isoform 3 (identifier: Q13085-3) Also known as: E5B; The sequence of this isoform differs from the canonical sequence as follows: 1-78: Missing. | ||||||
| Isoform 4 (identifier: Q13085-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2346 | 2346 | Acetyl-CoA carboxylase 1 | PRO_0000146764 | |||||
Regions | |||||||||
| Domain | 117 – 618 | 502 | Biotin carboxylation | ||||||
| Domain | 275 – 466 | 192 | ATP-grasp | ||||||
| Domain | 752 – 818 | 67 | Biotinyl-binding | ||||||
| Domain | 1698 – 2194 | 497 | Carboxyltransferase | ||||||
| Nucleotide binding | 315 – 320 | 6 | ATP Potential | ||||||
Sites | |||||||||
| Active site | 441 | 1 | By similarity | ||||||
| Metal binding | 424 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 437 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 437 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 439 | 1 | Manganese 2 By similarity | ||||||
| Binding site | 786 | 1 | Biotin (covalent) By similarity | ||||||
| Binding site | 1823 | 1 | Coenzyme A By similarity | ||||||
| Binding site | 2127 | 1 | Coenzyme A By similarity | ||||||
| Binding site | 2129 | 1 | Coenzyme A By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine | ||||||
| Modified residue | 23 | 1 | Phosphoserine | ||||||
| Modified residue | 25 | 1 | Phosphoserine | ||||||
| Modified residue | 29 | 1 | Phosphoserine | ||||||
| Modified residue | 48 | 1 | Phosphoserine | ||||||
| Modified residue | 50 | 1 | Phosphoserine | ||||||
| Modified residue | 53 | 1 | Phosphoserine | ||||||
| Modified residue | 56 | 1 | Phosphoserine | ||||||
| Modified residue | 58 | 1 | Phosphothreonine | ||||||
| Modified residue | 60 | 1 | Phosphoserine | ||||||
| Modified residue | 78 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 80 | 1 | Phosphoserine | ||||||
| Modified residue | 488 | 1 | Phosphoserine | ||||||
| Modified residue | 1042 | 1 | Phosphothreonine | ||||||
| Modified residue | 1201 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1263 | 1 | Phosphoserine | ||||||
| Modified residue | 1844 | 1 | Phosphoserine | ||||||
| Modified residue | 2099 | 1 | Phosphoserine | ||||||
| Modified residue | 2108 | 1 | Phosphotyrosine | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 78 | 78 | Missing in isoform 3. | VSP_026098 | |||||
| Alternative sequence | 1 – 75 | 75 | MDEPS…LALHI → MEGSPEENKEMRYYMLQ in isoform 2. | VSP_026099 | |||||
| Alternative sequence | 1 | 1 | M → MWWSTLMSILRARSFWKWIS TQTVRIIRAVRAHFGGIM in isoform 4. | VSP_026100 | |||||
| Natural variant | 838 | 1 | R → W: dbSNP rs2287351. | VAR_042941 | |||||
| Natural variant | 1687 | 1 | R → Q in a colorectal cancer sample; somatic mutation. | VAR_036514 | |||||
| Natural variant | 2271 | 1 | A → V Rare polymorphism; frequency <0.004; may play a role in breast cancer susceptibility. | VAR_028929 | |||||
Experimental info | |||||||||
| Mutagenesis | 78 | 1 | S → A: No effect on interaction with BRCA1 | ||||||
| Mutagenesis | 344 | 1 | S → A: No effect on interaction with BRCA1 | ||||||
| Mutagenesis | 432 | 1 | S → A: No effect on interaction with BRCA1 | ||||||
| Mutagenesis | 1201 | 1 | S → A: No effect on interaction with BRCA1 | ||||||
| Mutagenesis | 1263 | 1 | S → A: Abolishes interaction with BRCA1 | ||||||
| Mutagenesis | 1585 | 1 | S → A: No effect on interaction with BRCA1 | ||||||
| Mutagenesis | 1952 | 1 | S → A: No effect on interaction with BRCA1 | ||||||
| Mutagenesis | 2211 | 1 | S → A: No effect on interaction with BRCA1 | ||||||
| Sequence conflict | 66 | 1 | S → A in AAC50139. Ref.1 | ||||||
| Sequence conflict | 79 | 1 | M → W in AAC50139. Ref.1 | ||||||
| Sequence conflict | 89 | 1 | R → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 182 | 1 | P → A in AAC50139. Ref.1 | ||||||
| Sequence conflict | 234 | 1 | S → N in AAC50139. Ref.1 | ||||||
| Sequence conflict | 299 | 1 | Q → K in AAC50139. Ref.1 | ||||||
| Sequence conflict | 303 | 1 | E → K in AAC50139. Ref.1 | ||||||
| Sequence conflict | 364 | 1 | A → V in AAP94122. Ref.2 | ||||||
| Sequence conflict | 446 | 1 | H → Q in AAC50139. Ref.1 | ||||||
| Sequence conflict | 494 | 1 | D → N in AAC50139. Ref.1 | ||||||
| Sequence conflict | 554 | 1 | D → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 622 | 1 | Q → R in AAC50139. Ref.1 | ||||||
| Sequence conflict | 640 | 1 | A → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 814 | 1 | V → I in AAP94122. Ref.2 | ||||||
| Sequence conflict | 1061 | 1 | N → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1094 – 1095 | 2 | EL → DV in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1225 | 1 | S → A in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1257 | 1 | S → C in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1297 | 1 | C → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1320 | 1 | V → A in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1444 | 1 | N → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1474 | 1 | F → L in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1665 – 1666 | 2 | TF → SL in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1677 | 1 | I → V in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1741 | 1 | P → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1762 | 1 | S → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1822 | 1 | C → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1875 | 1 | M → T in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1888 | 1 | D → G in AAC50139. Ref.1 | ||||||
| Sequence conflict | 1997 | 1 | I → V in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2013 | 1 | Q → H in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2058 | 1 | D → H in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2075 | 1 | C → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2098 – 2099 | 2 | SS → PT in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2158 – 2159 | 2 | TA → PT in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2166 | 1 | N → S in AAC50139. Ref.1 | ||||||
| Sequence conflict | 2234 | 1 | N → S in AAC50139. Ref.1 | ||||||

Clusters with