Skip Header

 
Contribute Send feedback

Reviewed, UniProtKB/Swiss-Prot Q13085 (ACACA_HUMAN)

Last modified November 25, 2008. Version 87. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data | Customize display text xml rdf/xml gff fasta
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Binary interactions · Alternative products · Sequence annotation (Features) · Sequences · References · Web resources · Cross-references · Entry information · Relevant documents

Names and origin

Protein namesRecommended name:
    Acetyl-CoA carboxylase 1
    EC=6.4.1.2
Alternative name(s):
    ACC-alpha
Including the following 1 domains:
    1- Recommended name:
            Biotin carboxylase
              EC=6.3.4.14
Gene names
Name: ACACA
Synonyms: ACAC, ACC1, ACCA
OrganismHomo sapiens (Human)
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2346 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is not processed.
Protein existenceEvidence at protein level.

General annotation (Comments)

Function

Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.

Catalytic activity

ATP + acetyl-CoA + HCO(3)(-) = ADP + phosphate + malonyl-CoA.

ATP + biotin-carboxyl-carrier protein + CO(2) = ADP + phosphate + carboxybiotin-carboxyl-carrier protein.

Cofactor

Biotin.

Binds 2 manganese ions per subunit.

Enzyme regulation

By phosphorylation By similarity.

Pathway

Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA from acetyl-CoA: step 1/1.

Subunit structure

Interacts in its inactive phosphorylated form with the BRCT domains of BRCA1 which prevents ACACA dephosphorylation and inhibits lipid synthesis.

Subcellular location

Cytoplasm.

Tissue specificity

Expressed in brain, placental, skeletal muscle, renal, pancreatic and adipose tissues; expressed at low level in pulmonary tissue; not detected in the liver.

Post-translational modification

Phosphorylation on Ser-1263 is required for interaction with BRCA1.

Involvement in disease

Defects in ACACA are a cause of ACACA deficiency [MIM:200350]; also called ACAC or ACC deficiency. ACACA deficiency is an inborn error of de novo fatty acid synthesis. The disorder is associated with severe brain damage, persistent myopathy and poor growth.

Sequence similarities

Contains 1 ATP-grasp domain.

Contains 1 biotin carboxylation domain.

Contains 1 biotinyl-binding domain.

Contains 1 carboxyltransferase domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

AKR1B10O602183EBI-717681,EBI-1572139
BRCA1P383982EBI-717681,EBI-349905

Alternative products

This entry describes 4 isoforms produced by alternative promoter usage. [Align] [Select]
Isoform 1 (identifier: Q13085-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q13085-2)

Also known as: E5A;

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: MDEPSPLAQP...SLQDGLALHI → MEGSPEENKEMRYYMLQ
Isoform 3 (identifier: Q13085-3)

Also known as: E5B;

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.
Isoform 4 (identifier: Q13085-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 23462346Acetyl-CoA carboxylase 1
PRO_0000146764

Regions

Domain117 – 618502Biotin carboxylation
Domain275 – 466192ATP-grasp
Domain752 – 81867Biotinyl-binding
Domain1698 – 2194497Carboxyltransferase
Nucleotide binding315 – 3206ATP Potential

Sites

Active site4411 By similarity
Metal binding4241Manganese 1 By similarity
Metal binding4371Manganese 1 By similarity
Metal binding4371Manganese 2 By similarity
Metal binding4391Manganese 2 By similarity
Binding site7861Biotin (covalent) By similarity
Binding site18231Coenzyme A By similarity
Binding site21271Coenzyme A By similarity
Binding site21291Coenzyme A By similarity

Amino acid modifications

Modified residue11N-acetylmethionine
Modified residue231Phosphoserine
Modified residue251Phosphoserine
Modified residue291Phosphoserine
Modified residue481Phosphoserine
Modified residue501Phosphoserine
Modified residue531Phosphoserine
Modified residue561Phosphoserine
Modified residue581Phosphothreonine
Modified residue601Phosphoserine
Modified residue781Phosphoserine By similarity
Modified residue801Phosphoserine
Modified residue4881Phosphoserine
Modified residue10421Phosphothreonine
Modified residue12011Phosphoserine By similarity
Modified residue12631Phosphoserine
Modified residue18441Phosphoserine
Modified residue20991Phosphoserine
Modified residue21081Phosphotyrosine

Natural variations

Alternative sequence1 – 7878Missing in isoform 3.
VSP_026098
Alternative sequence1 – 7575MDEPS…LALHI → MEGSPEENKEMRYYMLQ in isoform 2.
VSP_026099
Alternative sequence11M → MWWSTLMSILRARSFWKWIS TQTVRIIRAVRAHFGGIM in isoform 4.
VSP_026100
Natural variant8381R → W: dbSNP rs2287351.
VAR_042941
Natural variant16871R → Q in a colorectal cancer sample; somatic mutation.
VAR_036514
Natural variant22711A → V Rare polymorphism; frequency <0.004; may play a role in breast cancer susceptibility.
VAR_028929

Experimental info

Mutagenesis781S → A: No effect on interaction with BRCA1
Mutagenesis3441S → A: No effect on interaction with BRCA1
Mutagenesis4321S → A: No effect on interaction with BRCA1
Mutagenesis12011S → A: No effect on interaction with BRCA1
Mutagenesis12631S → A: Abolishes interaction with BRCA1
Mutagenesis15851S → A: No effect on interaction with BRCA1
Mutagenesis19521S → A: No effect on interaction with BRCA1
Mutagenesis22111S → A: No effect on interaction with BRCA1
Sequence conflict661S → A in AAC50139. Ref.1
Sequence conflict791M → W in AAC50139. Ref.1
Sequence conflict891R → G in AAC50139. Ref.1
Sequence conflict1821P → A in AAC50139. Ref.1
Sequence conflict2341S → N in AAC50139. Ref.1
Sequence conflict2991Q → K in AAC50139. Ref.1
Sequence conflict3031E → K in AAC50139. Ref.1
Sequence conflict3641A → V in AAP94122. Ref.2
Sequence conflict4461H → Q in AAC50139. Ref.1
Sequence conflict4941D → N in AAC50139. Ref.1
Sequence conflict5541D → G in AAC50139. Ref.1
Sequence conflict6221Q → R in AAC50139. Ref.1
Sequence conflict6401A → G in AAC50139. Ref.1
Sequence conflict8141V → I in AAP94122. Ref.2
Sequence conflict10611N → S in AAC50139. Ref.1
Sequence conflict1094 – 10952EL → DV in AAC50139. Ref.1
Sequence conflict12251S → A in AAC50139. Ref.1
Sequence conflict12571S → C in AAC50139. Ref.1
Sequence conflict12971C → G in AAC50139. Ref.1
Sequence conflict13201V → A in AAC50139. Ref.1
Sequence conflict14441N → S in AAC50139. Ref.1
Sequence conflict14741F → L in AAC50139. Ref.1
Sequence conflict1665 – 16662TF → SL in AAC50139. Ref.1
Sequence conflict16771I → V in AAC50139. Ref.1
Sequence conflict17411P → S in AAC50139. Ref.1
Sequence conflict17621S → G in AAC50139. Ref.1
Sequence conflict18221C → S in AAC50139. Ref.1
Sequence conflict18751M → T in AAC50139. Ref.1
Sequence conflict18881D → G in AAC50139. Ref.1
Sequence conflict19971I → V in AAC50139. Ref.1
Sequence conflict20131Q → H in AAC50139. Ref.1
Sequence conflict20581D → H in AAC50139. Ref.1
Sequence conflict20751C → S in AAC50139. Ref.1
Sequence conflict2098 – 20992SS → PT in AAC50139. Ref.1
Sequence conflict2158 – 21592TA → PT in AAC50139. Ref.1
Sequence conflict21661N → S in AAC50139. Ref.1
Sequence conflict22341N → S in AAC50139. Ref.1