Reviewed,
UniProtKB/Swiss-Prot Q643R3 (PLCG_HUMAN)
Last modified
September 2, 2008.
Version 42.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: 1-acyl-sn-glycerol-3-phosphate acyltransferase eta EC=2.3.1.51 Alternative name(s): 1-AGP acyltransferase 7 Short name=1-AGPAT 7 Lysophosphatidic acid acyltransferase eta Short name=LPAAT-eta Acyltransferase-like 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 524 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone By similarity. |
| Catalytic activity | Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate. |
| Pathway | |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. |
| Tissue specificity | Widely expressed. Expressed in uterus, thymus, pancreas, skeletal muscle, bladder, stomach, lung and testis. |
| Sequence similarities | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. |
| Sequence caution | The sequence AAN33178.1 differs from that shown. Reason: Frameshift at position 198. The sequence AAP97722.1 differs from that shown. Reason: Frameshift at positions 188 and 198. |
Ontologies
Keywords | |
|---|---|
| Biological process | Phospholipid biosynthesis |
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane |
| Molecular function | Acyltransferase Transferase |
| PTM | Glycoprotein |
Gene Ontology (GO) | |
| Cellular component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q643R3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: Q643R3-2) The sequence of this isoform differs from the canonical sequence as follows: 415-447: LFAEEQAEGPNRLLYKDGFSTILHLLLGSPHPA → VMGGGGGGGCLVAMLTPLQEAYFGMLFPVASRY 448-524: Missing. | |||||
| Notes: No experimental confirmation available. Ref.4 (AAC19156) sequence differs from that shown due to a frameshift in position 327. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 524 | 524 | 1-acyl-sn-glycerol-3-phosphate acyltransferase eta | |||||
Regions | ||||||||
| Transmembrane | 40 – 62 | 23 | Potential | |||||
| Transmembrane | 87 – 107 | 21 | Potential | |||||
| Motif | 129 – 134 | 6 | HXXXXD motif | |||||
Amino acid modifications | ||||||||
| Glycosylation | 152 | 1 | N-linked (GlcNAc...) Potential | |||||
Natural variations | ||||||||
| Alternative sequence | 415 – 447 | 33 | LFAEE…SPHPA → VMGGGGGGGCLVAMLTPLQE AYFGMLFPVASRY in isoform 2. | |||||
| Alternative sequence | 448 – 524 | 77 | Missing in isoform 2. | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization a novel human 1-acyl-sn-glycerol-3-phosphate acyltransferase gene AGPAT7." Ye G.-M., Chen C., Huang S., Han D.-D., Guo J.-H., Wan B., Yu L. DNA Seq. 16:386-390(2005) [PubMed: 16243729] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Testis. |
| [2] | Guo J.H., Yu L. Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Ovary. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [4] | Yu W., Sarginson J., Gibbs R.A. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 268-524 (ISOFORM 2). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AY734233 mRNA. Translation: AAU34184.1. AF529233 mRNA. Translation: AAP97722.1. Frameshift. AF542964 mRNA. Translation: AAN33178.1. Frameshift. BC024892 mRNA. Translation: AAH24892.2. BC092463 mRNA. Translation: AAH92463.1. AF007155 mRNA. Translation: AAC19156.1. Frameshift. | |
| RefSeq | NP_705841.2. |
| UniGene | Hs.352614 |
3D structure databases | |
| ModBase | Search... |
Genome annotation databases | |
| Ensembl | ENSG00000176454. Homo sapiens. [Contig view] |
| GeneID | 254531. |
| KEGG | hsa:254531. |
Organism-specific databases | |
| HGNC | HGNC:30059. AGPAT7. |
| PharmGKB | PA142672638. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | Q643R3. |
| HOVERGEN | Q643R3. |
Gene expression databases | |
| GermOnline | ENSG00000176454. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002123. Acyltransferase. [Graphical view] |
| Pfam | PF01553. Acyltransferase. 1 hit. [Graphical view] |
| SMART | SM00563. PlsC. 1 hit. [Graphical view] |
| ProDom | Q643R3. [Graphical view] [Entries sharing at least one domain] |
| BLOCKS | Search... |
Other Resources | |
| ProtoNet | Search... |
Entry information
| Entry name | PLCG_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q643R3 Secondary accession number(s): O43412 Q8TB38 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


