Reviewed,
UniProtKB/Swiss-Prot Q6H8Q1 (ABLM2_HUMAN)
Last modified
September 2, 2008.
Version 53.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Actin-binding LIM protein 2 Alternative name(s): Actin-binding LIM protein family member 2 Short name=abLIM-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 611 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity. |
| Subunit structure | Interacts with F-actin and ABRA. |
| Subcellular location | Cytoplasm. Note= In skeletal muscle, sarcomeric or cosarcomeric localization By similarity. |
| Tissue specificity | Highly expressed in skeletal muscle. |
| Sequence similarities | Contains 1 HP (headpiece) domain. Contains 4 LIM zinc-binding domains. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | LIM domain Repeat |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
Gene Ontology (GO) | |
| Cellular component | cytoplasm Non-traceable author statement. Source: UniProtKB |
| Molecular function | zinc ion binding Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q6H8Q1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: Q6H8Q1-2) The sequence of this isoform differs from the canonical sequence as follows: 506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q | |||||
| Isoform 3 (identifier: Q6H8Q1-3) The sequence of this isoform differs from the canonical sequence as follows: 349-349: E → ESPQLLSPTPTE 390-441: Missing. 506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q | |||||
| Isoform 4 (identifier: Q6H8Q1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-243: Missing. 349-349: E → ESPQLLSPTPTE 389-422: Missing. 459-459: K → KQ | |||||
| Notes: No experimental confirmation available. | |||||
| Isoform 5 (identifier: Q6H8Q1-5) The sequence of this isoform differs from the canonical sequence as follows: 459-459: K → KQ 506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q | |||||
| Notes: No experimental confirmation available. | |||||
| Isoform 6 (identifier: Q6H8Q1-6) The sequence of this isoform differs from the canonical sequence as follows: 349-349: E → ESPQLLSPTPTE 390-441: Missing. 459-459: K → KQ 507-510: FPYS → EWFF 511-611: Missing. | |||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | |||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 611 | 611 | Actin-binding LIM protein 2 | ||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||
| Domain | 22 – 81 | 60 | LIM zinc-binding 1 | ||||||||||||||||||||||||||||||||||||
| Domain | 81 – 141 | 61 | LIM zinc-binding 2 | ||||||||||||||||||||||||||||||||||||
| Domain | 151 – 210 | 60 | LIM zinc-binding 3 | ||||||||||||||||||||||||||||||||||||
| Domain | 210 – 270 | 61 | LIM zinc-binding 4 | ||||||||||||||||||||||||||||||||||||
| Domain | 543 – 611 | 69 | HP | ||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 289 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 294 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 296 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
| Modified residue | 476 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 243 | 243 | Missing in isoform 4. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 349 | 1 | E → ESPQLLSPTPTE in isoform 3, isoform 4 and isoform 6. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 389 – 422 | 34 | Missing in isoform 4. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 390 – 441 | 52 | Missing in isoform 3 and isoform 6. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 459 | 1 | K → KQ in isoform 4, isoform 5 and isoform 6. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 506 – 545 | 40 | RFPYS…WGMRE → Q in isoform 2, isoform 3 and isoform 5. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 507 – 510 | 4 | FPYS → EWFF in isoform 6. | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 511 – 611 | 101 | Missing in isoform 6. | ||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 240 | 1 | R → G in BAC04414. Ref.2 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 312 | 1 | D → G in BAC04414. Ref.2 | ||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Helix | 75 – 77 | 3 | |||||||||||||||||||||||||||||||||||||
| Turn | 84 – 86 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 95 – 97 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 100 – 102 | 3 | |||||||||||||||||||||||||||||||||||||
| Turn | 104 – 106 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 110 – 112 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 118 – 120 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 122 – 125 | 4 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 128 – 131 | 4 | |||||||||||||||||||||||||||||||||||||
| Helix | 132 – 135 | 4 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 213 – 215 | 3 | |||||||||||||||||||||||||||||||||||||
| Turn | 233 – 235 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 239 – 241 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 252 – 254 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 257 – 259 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 263 – 266 | 4 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure and transcriptional activity of the ABLIM2 gene of human, mouse and rat." Klimov E.A., Rakhmanaliev E.R., Rudco O.I. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: PNS. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. DNA Res. 8:85-95(2001) [PubMed: 11347906] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 34-611 (ISOFORM 2). Tissue: Brain. |
| [5] | The German cDNA consortium Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 390-572 (ISOFORM 5). Tissue: Amygdala. |
| [6] | "Solution structure of the LIM domain of the human actin binding LIM protein 2." RIKEN structural genomics initiative (RSGI) Submitted (JUN-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 73-140. |
| [7] | "Two novel members of the ABLIM protein family, ABLIM-2 and -3, associate with STARS and directly bind F-actin." Barrientos T., Frank D., Kuwahara K., Bezprozvannaya S., Pipes G.C.T., Bassel-Duby R., Richardson J.A., Katus H.A., Olson E.N., Frey N. J. Biol. Chem. 282:8393-8403(2007) [PubMed: 17194709] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH ABRA. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AJ748600 mRNA. Translation: CAG38375.1. AJ748601 mRNA. Translation: CAG38376.1. AK094754 mRNA. Translation: BAC04414.1. AK094798 mRNA. Translation: BAC04427.1. BC067214 mRNA. Translation: AAH67214.1. Different initiation. AB058711 mRNA. Translation: BAB47437.1. AL834195 mRNA. Translation: CAD38885.2. | |||||||||||||||||||
| UniGene | Hs.233404 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| SMR | Q6H8Q1. Positions 540-611. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q6H8Q1. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSG00000163995. Homo sapiens. [Contig view] | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| HGNC | HGNC:19195. ABLIM2. | ||||||||||||||||||
| PharmGKB | PA134940437. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||

Clusters with