Reviewed,
UniProtKB/Swiss-Prot Q6P656 (CO026_HUMAN)
Last modified
July 22, 2008.
Version 29.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Uncharacterized protein C15orf26 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 301 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
Ontologies
Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q6P656-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: Q6P656-2) The sequence of this isoform differs from the canonical sequence as follows: 1-25: Missing. 194-224: QAAFPDPQLRLEYEGFPVPANAKILINHCHT → NMKASPSRQMLKFSSITVTQIGDWQPTGIFS 225-301: Missing. | |||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 301 | 301 | Uncharacterized protein C15orf26 | |||||
Natural variations | ||||||||
| Alternative sequence | 1 – 25 | 25 | Missing in isoform 2. | |||||
| Alternative sequence | 194 – 224 | 31 | QAAFP…NHCHT → NMKASPSRQMLKFSSITVTQ IGDWQPTGIFS in isoform 2. | |||||
| Alternative sequence | 225 – 301 | 77 | Missing in isoform 2. | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Heart. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
Cross-references
Sequence databases | |
|---|---|
| AK095934 mRNA. Translation: BAC04653.1. BC062471 mRNA. Translation: AAH62471.1. | |
| RefSeq | NP_775799.2. |
| UniGene | Hs.130979 |
3D structure databases | |
| ModBase | Search... |
Genome annotation databases | |
| Ensembl | ENSG00000156206. Homo sapiens. [Contig view] |
| GeneID | 161502. |
| KEGG | hsa:161502. |
Organism-specific databases | |
| HGNC | HGNC:26782. C15orf26. |
| PharmGKB | PA134908662. |
| GenAtlas | Search... |
| GeneCards | Search... |
| GeneLynx | Search... |
Phylogenomic databases | |
| HOGENOM | Q6P656. |
| HOVERGEN | Q6P656. |
Gene expression databases | |
| ArrayExpress | Q6P656. |
| CleanEx | HS_C15orf26. |
| GermOnline | ENSG00000156206. Homo sapiens. |
Family and domain databases | |
| ProDom | Q6P656. [Graphical view] [Entries sharing at least one domain] |
| BLOCKS | Search... |
Other Resources | |
| ProtoNet | Search... |
Entry information
| Entry name | CO026_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6P656 Secondary accession number(s): Q8N906 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |

Clusters with


