Reviewed,
UniProtKB/Swiss-Prot Q7Z2E3 (APTX_HUMAN)
Last modified
July 22, 2008.
Version 57.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Aprataxin EC=3.-.-.- Alternative name(s): Forkhead-associated domain histidine triad-like protein Short name(s)=FHA-HIT | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 356 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | DNA-binding protein involved in single-strand DNA break repair, double-strand DNA break repair and base excision repair. Resolves abortive DNA ligation intermediates formed either at base excision sites, or when DNA ligases attempt to repair non-ligatable breaks induced by reactive oxygen species. Catalyzes the release of adenylate groups covalently linked to 5'-phosphate termini, resulting in the production of 5'-phosphate termini that can be efficiently rejoined. Also able to hydrolyze adenosine 5'-monophosphoramidate (AMP-NH(2)) and diadenosine tetraphosphate (AppppA), but with lower catalytic activity. |
| Subunit structure | Interacts with single-strand break repair proteins XRCC1, XRCC4, ADPRT and p53/TP53. Interacts with NCL. |
| Subcellular location | Nucleus › nucleoplasm. Nucleus › nucleolus. Note= Upon genotoxic stress, colocalizes with XRCC1 at sites of DNA damage. Interaction with NCL is required for nucleolar localization. |
| Tissue specificity | Widely expressed. In brain, it is expressed in the posterior cortex, cerebellum, hippocampus and olfactory bulb. Isoform 1 is highly expressed in the cerebral cortex and cerebellum, compared to isoform 2. |
| Domain | The histidine triad, also called HIT motif, forms part of the binding loop for the alpha-phosphate of purine mononucleotide By similarity. The FHA-like domain mediates interaction with NCL; XRCC1 and XRCC4. The HIT domain is required for enzymatic activity. The C2H2-type zinc finger mediates DNA-binding. |
| Involvement in disease | Defects in APTX are the cause of ataxia-oculomotor apraxia syndrome (AOA) [MIM:208920]. AOA is an autosomal recessive syndrome characterized by early-onset cerebellar ataxia, oculomotor apraxia, early areflexia and late peripheral neuropathy. Defects in APTX are a cause of coenzyme Q10 deficiency [MIM:607426]. Coenzyme Q10 deficiency is an autosomal recessive disorder with variable manifestations. It can be associated with three main clinical phenotypes: a predominantly myopathic form with central nervous system involvement, an infantile encephalomyopathy with renal dysfunction and an ataxic form with cerebellar atrophy. Coenzyme Q10 deficiency due to APTX mutations is typically associated with cerebellar ataxia. |
| Sequence similarities | Contains 1 C2H2-type zinc finger. Contains 1 FHA-like domain. Contains 1 HIT domain. |
| Biophysicochemical properties | Kinetic parameters: KM=18 µM for AppppA KM=837.5 µM for AMP-NH(2) |
Ontologies
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q7Z2E3-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Notes: Major form. | |||||
| Isoform 2 (identifier: Q7Z2E3-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 1-188: Missing. | |||||
| Notes: Minor form. | |||||
| Isoform 3 (identifier: Q7Z2E3-3) The sequence of this isoform differs from the canonical sequence as follows: 104-175: Missing. | |||||
| Notes: May be an aberrant isoform present in cancer cell lines. | |||||
| Isoform 4 (identifier: Q7Z2E3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-102: Missing. | |||||
| Notes: May be an aberrant isoform present in cancer cell lines. | |||||
| Isoform 5 (identifier: Q7Z2E3-5) The sequence of this isoform differs from the canonical sequence as follows: 1-14: Missing. 59-112: Missing. | |||||
| Notes: May be an aberrant isoform present in cancer cell lines. | |||||
| Isoform 6 (identifier: Q7Z2E3-6) The sequence of this isoform differs from the canonical sequence as follows: 1-193: Missing. 306-356: AVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ → E | |||||
| Notes: May be an aberrant isoform present in cancer cell lines. | |||||
| Isoform 7 (identifier: Q7Z2E3-7) The sequence of this isoform differs from the canonical sequence as follows: 1-14: Missing. | |||||
| Isoform 8 (identifier: Q7Z2E3-8) The sequence of this isoform differs from the canonical sequence as follows: 175-193: Missing. | |||||
| Notes: May be an aberrant isoform present in cancer cell lines. | |||||
| Isoform 9 (identifier: Q7Z2E3-9) The sequence of this isoform differs from the canonical sequence as follows: 1-14: Missing. 306-356: AVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ → E | |||||
| Notes: No experimental confirmation available. | |||||
| Isoform 10 (identifier: Q7Z2E3-10) The sequence of this isoform differs from the canonical sequence as follows: 59-112: Missing. | |||||
| Notes: May be an aberrant isoform present in cancer cell lines. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 356 | 356 | Aprataxin | |||||
Regions | ||||||||
| Domain | 38 – 87 | 50 | FHA-like | |||||
| Domain | 182 – 287 | 106 | HIT | |||||
| Zinc finger | 331 – 353 | 23 | C2H2-type | |||||
| Region | 1 – 110 | 110 | Interactions with ADPRT and NCL | |||||
| Motif | 126 – 131 | 6 | Nuclear localization signal Probable | |||||
| Motif | 272 – 276 | 5 | Histidine triad motif | |||||
Sites | ||||||||
| Active site | 274 | 1 | Tele-AMP-histidine intermediate Probable | |||||
Natural variations | ||||||||
| Alternative sequence | 1 – 193 | 193 | Missing in isoform 6. | |||||
| Alternative sequence | 1 – 188 | 188 | Missing in isoform 2. | |||||
| Alternative sequence | 1 – 102 | 102 | Missing in isoform 4. | |||||
| Alternative sequence | 1 – 14 | 14 | Missing in isoform 5, isoform 7 and isoform 9. | |||||
| Alternative sequence | 59 – 112 | 54 | Missing in isoform 5 and isoform 10. | |||||
| Alternative sequence | 104 – 175 | 72 | Missing in isoform 3. | |||||
| Alternative sequence | 175 – 193 | 19 | Missing in isoform 8. | |||||
| Alternative sequence | 306 – 356 | 51 | AVIEM…KHWTQ → E in isoform 6 and isoform 9. | |||||
| Natural variant | 211 | 1 | K → Q in AOA; it probably does not greatly affect the protein; heterozygous. | |||||
| Natural variant | 212 | 1 | A → V in AOA; heterozygous. | |||||
| Natural variant | 213 | 1 | R → H in AOA. | |||||
| Natural variant | 215 | 1 | H → R in AOA. | |||||
| Natural variant | 220 | 1 | P → L in AOA. | |||||
| Natural variant | 237 | 1 | L → P in AOA. | |||||
| Natural variant | 277 | 1 | V → G in AOA; abolishes DNA-binding and enzymatic activity towards Ap(4)A. | |||||
| Natural variant | 281 | 1 | D → G in AOA; heterozygous. | |||||
| Natural variant | 293 | 1 | W → R in AOA; heterozygous. | |||||
Experimental info | ||||||||
| Mutagenesis | 43 | 1 | R → A: Impairs interaction with XRCC1 and XRCC4 | |||||
| Mutagenesis | 274 | 1 | H → A: Abolishes enzyme activity | |||||
| Mutagenesis | 333 | 1 | C → A: Abolishes DNA-binding and enzyme activity; when associated to A-336 | |||||
| Mutagenesis | 336 | 1 | C → A: Abolishes DNA-binding and enzyme activity; when associated to A-333 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of FHA-HIT as a novel nuclear protein involved in cell-cycle regulation." Huang C.-H. Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | Chen Y., Huang C.-H. Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8 AND 10). Tissue: Hypothalamus, Kidney, Lung adenocarcinoma, Lymphoma, Melanoma, Muscle, Retinoblastoma, Skin and Testis. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon. |
| [4] | The German cDNA consortium Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9). Tissue: Endometrium. |
| [5] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. |

Clusters with