Reviewed,
UniProtKB/Swiss-Prot Q86Y56 (HEAT2_HUMAN)
Last modified
November 25, 2008.
Version 49.
History...
Clusters with 100%,
90%,
50% identity |
 Documents (2) |
 Third-party data |
 Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Binary interactions · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: HEAT repeat-containing protein 2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 855 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
Ontologies
Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Technical term | Direct protein sequencing |
Gene Ontology (GO) | |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BRF2 | Q9HAW0 | 1 | EBI-719966,EBI-1055224 | |
| CASP4 | P49662 | 1 | EBI-719966,EBI-1057327 | |
| CIAO1 | O76071 | 1 | EBI-719966,EBI-725145 | |
| GSTK1 | Q9Y2Q3 | 1 | EBI-719966,EBI-1053767 | |
| ILK | Q13418 | 1 | EBI-719966,EBI-747644 | |
| MAGEA6 | P43360 | 1 | EBI-719966,EBI-1045155 | |
| MAGED1 | Q9Y5V3 | 1 | EBI-719966,EBI-716006 | |
| PGRMC1 | O00264 | 1 | EBI-719966,EBI-1045534 | |
| PHLDA3 | Q9Y5J5 | 1 | EBI-719966,EBI-1055859 | |
| PNKP | Q96T60 | 1 | EBI-719966,EBI-1045072 | |
| PTP4A3 | O75365 | 1 | EBI-719966,EBI-1043866 | |
| TSC22D1 | Q15714 | 1 | EBI-719966,EBI-712609 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86Y56-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86Y56-2) The sequence of this isoform differs from the canonical sequence as follows: 811-855: EVLKEGSGLF...QHVQAVPATQ → DVPGSPSPSAMIGSFLRPPHPWRTVSQLNLFSS | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q86Y56-3) The sequence of this isoform differs from the canonical sequence as follows: 1-620: Missing. | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 855 | 855 | HEAT repeat-containing protein 2 | PRO_0000050820 | |||||
Regions | |||||||||
| Repeat | 71 – 109 | 39 | HEAT 1 | ||||||
| Repeat | 202 – 240 | 39 | HEAT 2 | ||||||
| Repeat | 241 – 278 | 38 | HEAT 3 | ||||||
| Repeat | 280 – 318 | 39 | HEAT 4 | ||||||
| Repeat | 354 – 376 | 23 | HEAT 5 | ||||||
| Repeat | 377 – 414 | 38 | HEAT 6 | ||||||
| Repeat | 599 – 638 | 40 | HEAT 7 | ||||||
| Repeat | 696 – 734 | 39 | HEAT 8 | ||||||
| Repeat | 738 – 776 | 39 | HEAT 9 | ||||||
| Repeat | 784 – 822 | 39 | HEAT 10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 620 | 620 | Missing in isoform 3. | VSP_016109 | |||||
| Alternative sequence | 811 – 855 | 45 | EVLKE…VPATQ → DVPGSPSPSAMIGSFLRPPH PWRTVSQLNLFSS in isoform 2. | VSP_016110 | |||||
Experimental info | |||||||||
| Sequence conflict | 419 – 421 | 3 | SCT → TSS in AAH10850. Ref.1 | ||||||
| Sequence conflict | 454 | 1 | L → M in AAH47240. Ref.1 | ||||||
| Sequence conflict | 743 | 1 | K → R in AAH47240. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.  Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Colon carcinoma. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Hippocampus and Pancreas. |
| [3] | Bienvenut W.V. Submitted (JUN-2005) to UniProtKB Cited for: PROTEIN SEQUENCE OF 94-105; 423-438; 625-655 AND 804-814, MASS SPECTROMETRY. Tissue: B-cell lymphoma. |
| [4] | The German cDNA consortium Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 662-855 (ISOFORMS 1/3). Tissue: Melanoma. |
Cross-references
Sequence databases | |
|---|---|
| AK000404 mRNA. Translation: BAA91142.1. BC010850 mRNA. Translation: AAH10850.1. Different initiation. BC047240 mRNA. Translation: AAH47240.1. AL832914 mRNA. Translation: CAH10624.2. | |
| RefSeq | NP_060272.3. |
| UniGene | Hs.535896 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86Y56. |
PTM databases | |
| PhosphoSite | Q86Y56. |
Genome annotation databases | |
| Ensembl | ENSG00000164818. Homo sapiens. [Contig view] |
| GeneID | 54919. |
| KEGG | hsa:54919. |
Organism-specific databases | |
| HGNC | HGNC:26013. HEATR2. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | Q86Y56. |
| HOVERGEN | Q86Y56. |
Gene expression databases | |
| ArrayExpress | Q86Y56. |
| CleanEx | HS_HEATR2. |
| GermOnline | ENSG00000164818. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011989. ARM-like. IPR000357. HEAT. [Graphical view] |
| Gene3D | G3DSA:1.25.10.10. ARM-like. 1 hit. |
| Pfam | PF02985. HEAT. 6 hits. [Graphical view] |
| PROSITE | PS50077. HEAT_REPEAT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| LinkHub | Q86Y56. |
| NextBio | 57986. |
Entry information
| Entry name | HEAT2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86Y56 Secondary accession number(s): Q69YL1, Q96FI9, Q9NX75 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |
