Reviewed,
UniProtKB/Swiss-Prot Q8BHG2 (CA123_MOUSE)
Last modified
July 22, 2008.
Version 38.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: UPF0587 protein C1orf123 homolog |
| Organism | Mus musculus (Mouse) |
| Taxonomic identifier | 10090 [NCBI] |
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 160 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
Ontologies
Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q8BHG2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: Q8BHG2-2) The sequence of this isoform differs from the canonical sequence as follows: 136-160: DWTDYDEKAQESVGIFEVTHQFVKC → AHVFSSYNCFLQEGTQVWENDMIFLVRRPRDGV | |||||
| Isoform 3 (identifier: Q8BHG2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-2: MG → MEGVRLGWRGLSREGRGGAWHAAERTRPCTQRVPPSSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 160 | 160 | UPF0587 protein C1orf123 homolog | |||||
Natural variations | ||||||||
| Alternative sequence | 1 – 2 | 2 | MG → MEGVRLGWRGLSREGRGGAW HAAERTRPCTQRVPPSSQ in isoform 3. | |||||
| Alternative sequence | 136 – 160 | 25 | DWTDY…QFVKC → AHVFSSYNCFLQEGTQVWEN DMIFLVRRPRDGV in isoform 2. | |||||
Experimental info | ||||||||
| Sequence conflict | 25 | 1 | F → L in BAC34312. Ref.1 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Strain: C57BL/6J. Tissue: Hippocampus, Kidney, Olfactory bulb and Pancreas. |
| [2] | The mouse genome sequencing consortium Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: FVB/N. Tissue: Kidney. |
Cross-references
Sequence databases | |
|---|---|
| AK002776 mRNA. Translation: BAB22350.1. AK003575 mRNA. Translation: BAB22867.1. AK032590 mRNA. Translation: BAC27937.1. AK050486 mRNA. Translation: BAC34284.1. AK050533 mRNA. Translation: BAC34312.1. AK160674 mRNA. Translation: BAE35952.1. AL611936 Genomic DNA. Translation: CAM23586.1. BC019215 mRNA. Translation: AAH19215.1. | |
| UniGene | Mm.274853 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8BHG2. |
2-D gel databases | |
| REPRODUCTION-2DPAGE | Q8BHG2. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000028608. Mus musculus. [Contig view] |
Organism-specific databases | |
| MGI | MGI:1921348. 0610037L13Rik. |
Phylogenomic databases | |
| HOVERGEN | Q8BHG2. |
Gene expression databases | |
| ArrayExpress | Q8BHG2. |
| CleanEx | MM_0610037L13RIK. |
| GermOnline | ENSMUSG00000028608. Mus musculus. |
Family and domain databases | |
| InterPro | IPR008584. DUF866_euk. [Graphical view] |
| PANTHER | PTHR12857. DUF866_euk. 1 hit. |
| Pfam | PF05907. DUF866. 1 hit. [Graphical view] |
| ProDom | Q8BHG2. [Graphical view] [Entries sharing at least one domain] |
| BLOCKS | Search... |
Other Resources | |
| ProtoNet | Search... |
Entry information
| Entry name | CA123_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8BHG2 Secondary accession number(s): A2A8E3 Q9DCH5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |
| Uncharacterized protein families (UPF) List of uncharacterized protein family (UPF) entries |

Clusters with


