Reviewed,
UniProtKB/Swiss-Prot Q8BWR2 (CA128_MOUSE)
Last modified
July 22, 2008.
Version 38.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: UPF0424 protein C1orf128 homolog | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 211 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
Ontologies
Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q8BWR2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: Q8BWR2-2) The sequence of this isoform differs from the canonical sequence as follows: 193-211: ANPADHRVHQVTPQTHFIS → PNQQTTGCIRSLRRHTSFLKGQPGLPQMRC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 211 | 211 | UPF0424 protein C1orf128 homolog | |||||
Regions | ||||||||
| Compositional bias | 8 – 11 | 4 | Poly-Gly | |||||
Amino acid modifications | ||||||||
| Modified residue | 189 | 1 | Phosphotyrosine By similarity | |||||
Natural variations | ||||||||
| Alternative sequence | 193 – 211 | 19 | ANPAD…THFIS → PNQQTTGCIRSLRRHTSFLK GQPGLPQMRC in isoform 2. | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of TRP26, a novel member of the thioredoxin family, which is related to TRP32." Kondo N., Yodoi J., Tagaya Y. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Liver. |
| [3] | The mouse genome sequencing consortium Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF400670 mRNA. Translation: AAO85407.1. AK004208 mRNA. Translation: BAC25071.1. AK050261 mRNA. Translation: BAC34151.1. AL672076 Genomic DNA. Translation: CAM15906.1. BC052695 mRNA. Translation: AAH52695.1. | |
| RefSeq | NP_079687.3. |
| UniGene | Mm.29131 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8BWR2. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000028669. Mus musculus. [Contig view] |
| GeneID | 66193. |
| KEGG | mmu:66193. |
Organism-specific databases | |
| MGI | MGI:1913443. 1110049F12Rik. |
Phylogenomic databases | |
| HOVERGEN | Q8BWR2. |
Gene expression databases | |
| ArrayExpress | Q8BWR2. |
| CleanEx | MM_1110049F12RIK. |
Family and domain databases | |
| InterPro | IPR010400. DUF1000. [Graphical view] |
| Pfam | PF06201. DUF1000. 1 hit. [Graphical view] |
| ProDom | Q8BWR2. [Graphical view] [Entries sharing at least one domain] |
| BLOCKS | Search... |
Other Resources | |
| SOURCE | Search... |
| ProtoNet | Search... |
Entry information
| Entry name | CA128_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8BWR2 Secondary accession number(s): Q8BMZ1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |
| Uncharacterized protein families (UPF) List of uncharacterized protein family (UPF) entries |

Clusters with


