Reviewed,
UniProtKB/Swiss-Prot Q96DX5 (ASB9_HUMAN)
Last modified
July 22, 2008.
Version 57.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Ankyrin repeat and SOCS box protein 9 Short name=ASB-9 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 294 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins By similarity. |
| Pathway | |
| Domain | The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes By similarity. |
| Sequence similarities | Contains 6 ANK repeats. Contains 1 SOCS box domain. |
Ontologies
Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing |
| Domain | ANK repeat Repeat |
Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q96DX5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: Q96DX5-2) The sequence of this isoform differs from the canonical sequence as follows: 255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP | |||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 294 | 294 | Ankyrin repeat and SOCS box protein 9 | |||||
Regions | ||||||||
| Repeat | 35 – 64 | 30 | ANK 1 | |||||
| Repeat | 68 – 97 | 30 | ANK 2 | |||||
| Repeat | 101 – 130 | 30 | ANK 3 | |||||
| Repeat | 133 – 162 | 30 | ANK 4 | |||||
| Repeat | 166 – 195 | 30 | ANK 5 | |||||
| Repeat | 198 – 227 | 30 | ANK 6 | |||||
| Domain | 240 – 294 | 55 | SOCS box | |||||
Natural variations | ||||||||
| Alternative sequence | 255 – 294 | 40 | PPSLM…FLLHL → ASLPKPKP in isoform 2. | |||||
Experimental info | ||||||||
| Sequence conflict | 192 | 1 | D → V in CAB45706. Ref.1 | |||||
| Sequence conflict | 237 | 1 | E → G in CAB45706. Ref.1 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | The German cDNA consortium Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
Cross-references
Sequence databases | |
|---|---|
| AL080091 mRNA. Translation: CAB45706.2. Different initiation. AK000643 mRNA. Translation: BAA91302.1. BC013172 mRNA. Translation: AAH13172.1. | |
| RefSeq | NP_001026909.1. NP_076992.1. |
| UniGene | Hs.19404 |
3D structure databases | |
| ModBase | Search... |
2-D gel databases | |
| REPRODUCTION-2DPAGE | IPI00179183. |
Genome annotation databases | |
| Ensembl | ENSG00000102048. Homo sapiens. [Contig view] |
| GeneID | 140462. |
| KEGG | hsa:140462. |
Organism-specific databases | |
| HGNC | HGNC:17184. ASB9. |
| HPA | CAB004997. HPA000403. HPA003014. HPA003060. |
| PharmGKB | PA25037. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | Q96DX5. |
| HOVERGEN | Q96DX5. |
Gene expression databases | |
| ArrayExpress | Q96DX5. |
| CleanEx | HS_ASB9. |
| GermOnline | ENSG00000102048. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002110. ANK. IPR001496. SOCS_C. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. |
| Pfam | PF00023. Ank. 6 hits. PF07525. SOCS_box. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 6 hits. [Graphical view] |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 5 hits. PS50225. SOCS. 1 hit. [Graphical view] |
| ProDom | Q96DX5. [Graphical view] [Entries sharing at least one domain] |
| BLOCKS | Search... |
Other Resources | |
| LinkHub | Q96DX5. |
| ProtoNet | Search... |
Entry information
| Entry name | ASB9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96DX5 Secondary accession number(s): Q9NWS5, Q9Y4T3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


