Reviewed,
UniProtKB/Swiss-Prot Q96IU4 (ABHEB_HUMAN)
Last modified
July 22, 2008.
Version 52.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Abhydrolase domain-containing protein 14B EC=3.-.-.- Alternative name(s): CCG1-interacting factor B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 210 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subunit structure | May interact with TAF1. |
| Subcellular location | |
| Sequence similarities | Belongs to the AB hydrolase superfamily. ABHD14 family. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase |
| Technical term | 3D-structure |
Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q96IU4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: Q96IU4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-69: MAASVEQREG...AGYRAVAIDL → MGPGLFPAFLLRPQVTASTRLLPVCASPRSS | |||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 210 | 210 | Abhydrolase domain-containing protein 14B | |||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 111 | 1 | Charge relay system By similarity | |||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 162 | 1 | Charge relay system By similarity | |||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 188 | 1 | Charge relay system By similarity | |||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 69 | 69 | MAASV…VAIDL → MGPGLFPAFLLRPQVTASTR LLPVCASPRSS in isoform 2. | |||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 5 – 7 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 12 – 14 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 17 – 19 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 21 – 25 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 27 – 29 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 34 – 37 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 45 – 51 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 53 – 59 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 63 – 67 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 73 – 75 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 91 – 100 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 106 – 110 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 111 – 113 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 114 – 121 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 135 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 139 – 141 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 144 – 148 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 154 – 159 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 163 – 172 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 175 – 183 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 190 – 193 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 195 – 207 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Kidney, Ovarian carcinoma and Placenta. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Skin. |
| [3] | "Purification, crystallization and preliminary X-ray crystallographic analysis of human CCG1-interacting factor B." Padmanabhan B., Kuzuhara T., Mizuno H., Horikoshi M. Acta Crystallogr. D 56:1479-1481(2000) [PubMed: 11053859] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS), INTERACTION WITH TAF1, SUBCELLULAR LOCATION. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AK075034 mRNA. Translation: BAC11366.1. AK075112 mRNA. Translation: BAC11408.1. AK096073 mRNA. Translation: BAC04696.1. BC007234 mRNA. Translation: AAH07234.1. BC050650 mRNA. Translation: AAH50650.1. Different initiation. BC056411 mRNA. Translation: AAH56411.1. | |||||||||||||
| RefSeq | NP_116139.1. | ||||||||||||
| UniGene | Hs.420796 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein family/group databases | |||||||||||||
| MEROPS | S33.983. | ||||||||||||
2-D gel databases | |||||||||||||
| SWISS-2DPAGE | Q96IU4. | ||||||||||||
| OGP | Q96IU4. | ||||||||||||
| REPRODUCTION-2DPAGE | IPI00063827. | ||||||||||||
Proteomic databases | |||||||||||||
| PeptideAtlas | Q96IU4. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000114779. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 84836. | ||||||||||||
| KEGG | hsa:84836. | ||||||||||||
Organism-specific databases | |||||||||||||
| H-InvDB | HIX0003339. | ||||||||||||
| HGNC | HGNC:28235. ABHD14B. | ||||||||||||
| PharmGKB | PA142672660. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
| GeneCards | Search... | ||||||||||||
| GeneLynx | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | Q96IU4. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q96IU4. | ||||||||||||
| CleanEx | HS_ABHD14B. | ||||||||||||
| GermOnline | ENSG00000114779. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| ProDom | Q96IU4. [Graphical view] [Entries sharing at least one domain] | ||||||||||||
| BLOCKS | Search... | ||||||||||||
Other Resources | |||||||||||||
| ProtoNet | Search... | ||||||||||||
Entry information
| Entry name | ABHEB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96IU4 Secondary accession number(s): Q86VK8, Q8N8W5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


