Reviewed,
UniProtKB/Swiss-Prot Q9NR81 (ARHG3_HUMAN)
Last modified
September 2, 2008.
Version 57.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Rho guanine nucleotide exchange factor 3 Alternative name(s): Exchange factor found in platelets and leukemic and neuronal tissues Short name=XPLN | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 526 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases. |
| Subunit structure | Interacts with RHOA and RHOB. |
| Subcellular location | CytoplasmBy similarity. |
| Tissue specificity | Widely expressed. Highest levels are found in adult brain and skeletal muscle. Lower levels are found in heart and kidney. |
| Sequence similarities | Contains 1 DH (DBL-homology) domain. Contains 1 PH domain. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Guanine-nucleotide releasing factor |
Gene Ontology (GO) | |
| Biological process | Rho protein signal transduction Ref.1 Traceable author statement. Source: ProtInc |
| Cellular component | intracellular Inferred from direct assay. Source: LIFEdb |
| Molecular function | Rho guanyl-nucleotide exchange factor activity Ref.1 Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | |||||
| Isoform 1 (identifier: Q9NR81-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||
| Isoform 2 (identifier: Q9NR81-2) The sequence of this isoform differs from the canonical sequence as follows: 1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MDSSTAMNQC...AVSLCSLDIS | |||||
| Notes: No experimental confirmation available. | |||||
| Isoform 3 (identifier: Q9NR81-3) The sequence of this isoform differs from the canonical sequence as follows: 1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MIEVCHHNWLLWLCPSKFGIFMCCLASTTGQMELRRTR | |||||
| Notes: No experimental confirmation available. | |||||
| Isoform 4 (identifier: Q9NR81-4) The sequence of this isoform differs from the canonical sequence as follows: 1-202: Missing. 203-204: GW → MK | |||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | ||||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 526 | 526 | Rho guanine nucleotide exchange factor 3 | |||||
Regions | ||||||||
| Domain | 122 – 304 | 183 | DH | |||||
| Domain | 291 – 449 | 159 | PH | |||||
Natural variations | ||||||||
| Alternative sequence | 1 – 202 | 202 | Missing in isoform 4. | |||||
| Alternative sequence | 1 – 32 | 32 | MVAKD…AKDAE → MDSSTAMNQCSCRGMEENKE RPKRQRQNNFPMFPSPKAWN FRGRKRKQSTQDEDAVSLCS LDIS in isoform 2. | |||||
| Alternative sequence | 1 – 32 | 32 | MVAKD…AKDAE → MIEVCHHNWLLWLCPSKFGI FMCCLASTTGQMELRRTR in isoform 3. | |||||
| Alternative sequence | 203 – 204 | 2 | GW → MK in isoform 4. | |||||
| Natural variant | 13 | 1 | K → R: dbSNP rs3732507. | |||||
| Natural variant | 335 | 1 | L → V: dbSNP rs3772219. | |||||
Experimental info | ||||||||
| Sequence conflict | 410 | 1 | I → T in AAP97313. Ref.3 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation of two novel human RhoGEFs, ARHGEF3 and ARHGEF4, in 3p13-21 and 2q22." Thiesen S., Kuebart S., Ropers H.-H., Nothwang H.G. Biochem. Biophys. Res. Commun. 273:364-369(2000) [PubMed: 10873612] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [3] | Guo J.H., Yu L. Submitted (OCT-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT VAL-335. |
| [4] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno F.R. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT VAL-335. Tissue: Hippocampus and Uterus. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 71-526 (ISOFORMS 1/2/3). Tissue: Placenta. |
| [7] | "XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC." Arthur W.T., Ellerbroek S.M., Der C.J., Burridge K., Wennerberg K. J. Biol. Chem. 277:42964-42972(2002) [PubMed: 12221096] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF249744 mRNA. Translation: AAF79954.1. AL136832 mRNA. Translation: CAB66766.1. AF433662 mRNA. Translation: AAP97313.1. AB209661 mRNA. Translation: BAD92898.1. Different initiation. BC054345 mRNA. Translation: AAH54345.2. BC068513 mRNA. Translation: AAH68513.1. Different initiation. BC098122 mRNA. Translation: AAH98122.2. BC098272 mRNA. Translation: AAH98272.2. BC099715 mRNA. Translation: AAH99715.1. BC104723 mRNA. Translation: AAI04724.2. AK024340 mRNA. Translation: BAB14891.1. Different initiation. | |
| RefSeq | NP_001122088.1. NP_062455.1. |
| UniGene | Hs.476402 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1KI1 based on UniProtKB Q15811. |
| ModBase | Search... |
Genome annotation databases | |
| Ensembl | ENSG00000163947. Homo sapiens. [Contig view] |
| GeneID | 50650. |
| KEGG | hsa:50650. |
Organism-specific databases | |
| H-InvDB | HIX0003388. |
| HGNC | HGNC:683. ARHGEF3. |
| PharmGKB | PA24973. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9NR81. |
Enzyme and pathway databases | |
| Reactome | REACT_11044. Signaling by Rho GTPases. |
Gene expression databases | |
| ArrayExpress | Q9NR81. |
| CleanEx | HS_ARHGEF3. |
| GermOnline | ENSG00000163947. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000219. DH-domain. IPR001331. GDS_CDC24_CS. IPR001849. PH. IPR015721. RhoGEF_like. [Graphical view] |
| Gene3D | G3DSA:1.20.900.10. RhoGEF. 1 hit. |
| PANTHER | PTHR22825. RhoGEF_like. 1 hit. |
| Pfam | PF00169. PH. 1 hit. PF00621. RhoGEF. 1 hit. [Graphical view] |
| SMART | SM00233. PH. 1 hit. SM00325. RhoGEF. 1 hit. [Graphical view] |
| PROSITE | PS00741. DH_1. 1 hit. PS50010. DH_2. 1 hit. PS50003. PH_DOMAIN. 1 hit. [Graphical view] |
| ProDom | Q9NR81. [Graphical view] [Entries sharing at least one domain] |
| BLOCKS | Search... |
Other Resources | |
| ProtoNet | Search... |
Entry information
| Entry name | ARHG3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NR81 Secondary accession number(s): Q4FZB6 Q9H7T4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


